DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LDLR and yl

Sequence 1:NP_000518.1 Gene:LDLR HGNCID:6547 Length:860 Species:Homo sapiens
Sequence 2:NP_996433.1 Gene:yl FlyBaseID:FBgn0004649 Length:1984 Species:Drosophila melanogaster

Alignment Length:932 Identity:274/933 (29%)
Similarity:432/933 (46%) Gaps:206/933 (22%)


Human    12 VALLL---AAAGTAVG------DRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVT 67
            ::|||   ...|||.|      .||:..:|||:||.||....:|||..:|:|.|||         
  Fly    66 ISLLLLVGLCGGTAAGTPGSADTRCDAGQFQCRDGGCILQAKMCDGRGDCKDSSDE--------- 121

Human    68 CKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDR 132
                 ..|..|:  |.|..|                   ..|:|..     |.|::.:.:|:...
  Fly   122 -----LDCDYRL--CRPPHW-------------------FPCAQPH-----GACLAAELMCNGID 155

Human   133 DCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSS-- 195
            :|..|.||.:|||                                       |..:.| ||::  
  Fly   156 NCPGGEDELNCPV---------------------------------------RPGFRF-GDTAHR 180

Human   196 --PCSAFEFHCLSGE-CIHSSWRCDGGPDCKDKSDE-ENC--AVATCRPDEFQCSDGNCIHGSR- 253
              .||.:||.|.... ||...:.|||.|||.||||| ..|  |..||..:...|::|.|:...: 
  Fly   181 MRSCSKYEFMCQQDRTCIPIDFMCDGRPDCTDKSDEVAGCKQAEITCPGEGHLCANGRCLRRKQW 245

Human   254 QCDREYDCKDMSDEVGCVNVTLCE-GPNKFKCHSGE-CITLDKVCNMARDCRDWSDE-------P 309
            .||...||.|.|||.||:|  ||| ...||.|.:.| |:||.:||:...||.|.|||       |
  Fly   246 VCDGVDDCGDGSDERGCLN--LCEPQKGKFLCRNRETCLTLSEVCDGHSDCSDGSDETDLCHSKP 308

Human   310 IKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVA-QRRCEDIDECQD-PDTCSQLCVNLE 372
              :|...:|.  .|...|:..  ..|.||.||.||:|.. :.:|||:|||:: .|.|||.|.|..
  Fly   309 --DCDAKKCA--LGAKCHMMP--ASGAECFCPKGFRLAKFEDKCEDVDECKEQDDLCSQGCENTS 367

Human   373 GGYKCQCEEGFQLDPHTKACKAV--GS---IAYLFFTNRHEVRKMTLD----RSEYTSLIPNLRN 428
            |||:|.|:.|:.||...:.|:||  ||   ...|.:|.:..:..|.|.    |:....:..||..
  Fly   368 GGYRCVCDAGYLLDKDNRTCRAVVYGSKEQQPLLLYTTQMTIMGMHLREDNVRNHVYQVAGNLSK 432

Human   429 VVALDTEVASNRIYWSDLSQRMICSTQLDRAHG-VSSYDTVISRDIQAPDGLAVDWIHSNIYWTD 492
            |:.:..:  .:.|||:::...   :..:.:|:| .|:.:.:::..:.||:.|||||:..|||::|
  Fly   433 VIGVAYD--GSHIYWTNIQNE---AESIVKANGDGSNAEILLTSGLDAPEDLAVDWLTQNIYFSD 492

Human   493 SVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVT 557
            :::..::|....|:....|..::..:||::.|.|..|.|:|||||....|.:..::|.....:|:
  Fly   493 NIMRHIAVCSNDGLNCAVLVTQDVHQPRSLAVWPQKGLMFWTDWGEKPMIGRASMDGSRSRPIVS 557

Human   558 ENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTD 622
            :||:|||||.||:...|:||||:||.|:.::..:|..|:|:|:.  .|.||:.||:|||:::|:|
  Fly   558 DNIEWPNGIALDMHQQRIYWVDAKLGSVQTVRPDGTGRRTVLDG--MLKHPYGLAIFEDQLYWSD 620

Human   623 IINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPA-PQ 686
            ...:::.:.::.:|.|..:||:: .:...:.::|...||...:.||..|     |.:|||.| |:
  Fly   621 WATKSVHACHKFSGKDHRILAKD-RTIYAVHIYHPAKQPNSPHGCENAT-----CSHLCLLAEPE 679

Human   687 INPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAV-RTQHTTTRPVPDT- 749
            |..||    |||||||.||.|.|.|:...:..........|.|::..||. |.|.:.:..:|.. 
  Fly   680 IGGHS----CACPDGMRLAPDHRRCMLMEKRQRLFIGLGQVLLEIEHTAFGRHQVSKSYTLPCLI 740

Human   750 -----SRLPGA-----TPGLTTVEIVTMSHQA-------LGDVAGRG----------NEKKPSSV 787
                 :|:.|:     ......:|....||::       ||:|:...          .:.:.:.:
  Fly   741 NEMVYNRINGSLIIADNDQRLILEFQPESHESNVLVRSNLGNVSALAFDHLSRNLYWADTERAVI 805

Human   788 RALSI--------------VLPIVLLVFLCLG-VFLLWKNWRLKNINSINFDNPVYQKTTEDEVH 837
            ..||:              .:||.|.|....| ::::.|..|..:|:.|    |:..|  .::||
  Fly   806 EVLSLQTRHRALIRFFPGQEVPIGLTVMPAEGYLYVVLKAKRHSHIDKI----PLSGK--GEQVH 864

Human   838 ICHNQDGYSYPSRQMVSLEDDV 859
            :..:..|           :||:
  Fly   865 VFEDDLG-----------DDDI 875

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LDLRNP_000518.1 Ldl_recept_a 25..58 CDD:278486 16/33 (48%)
Ldl_recept_a 66..104 CDD:278486 5/38 (13%)
Ldl_recept_a 107..143 CDD:278486 9/36 (25%)
Ldl_recept_a 147..179 CDD:278486 0/32 (0%)
Ldl_recept_a 195..231 CDD:278486 18/42 (43%)
Ldl_recept_a 235..270 CDD:278486 14/36 (39%)
LDLa 278..308 CDD:294076 14/31 (45%)
FXa_inhibition 318..>346 CDD:291342 10/28 (36%)
EGF_CA 354..388 CDD:214542 18/35 (51%)
LDL-receptor class B 1 397..438 9/48 (19%)
LY 419..457 CDD:214531 6/38 (16%)
LDL-receptor class B 2 439..485 13/47 (28%)
Ldl_recept_b 439..482 CDD:278487 11/44 (25%)
LDL-receptor class B 3 486..528 11/42 (26%)
Ldl_recept_b 487..525 CDD:278487 10/38 (26%)
LDL-receptor class B 4 529..572 19/43 (44%)
Ldl_recept_b 529..569 CDD:278487 18/40 (45%)
LY 553..595 CDD:214531 19/42 (45%)
LDL-receptor class B 5 573..615 18/42 (43%)
LDL-receptor class B 6 616..658 8/42 (19%)
Ldl_recept_b 616..655 CDD:278487 7/39 (18%)
FXa_inhibition 671..711 CDD:291342 21/41 (51%)
Clustered O-linked oligosaccharides 721..768 10/59 (17%)
Required for MYLIP-triggered down-regulation of LDLR. {ECO:0000269|PubMed:19520913} 811..860 11/50 (22%)
NPXY motif. {ECO:0000269|PubMed:22509010} 823..828 1/5 (20%)
ylNP_996433.1 LDLa 90..124 CDD:238060 16/48 (33%)
LDLa 131..166 CDD:238060 11/59 (19%)
LDLa 184..216 CDD:238060 17/32 (53%)
LDLa 227..262 CDD:238060 13/35 (37%)
LDLa 271..302 CDD:238060 15/31 (48%)
FXa_inhibition 352..387 CDD:291342 15/35 (43%)
Ldl_recept_b 442..482 CDD:278487 11/43 (26%)
LY 466..508 CDD:214531 13/42 (31%)
Ldl_recept_b 529..569 CDD:278487 18/40 (45%)
LY 553..595 CDD:214531 19/42 (45%)
LY 596..637 CDD:214531 14/43 (33%)
FXa_inhibition 669..700 CDD:291342 20/35 (57%)
LY 774..815 CDD:214531 5/41 (12%)
LDLa 1032..1062 CDD:238060
LDLa 1074..1109 CDD:238060
LDLa 1118..1152 CDD:238060
LDLa 1157..1189 CDD:197566
LDLa 1198..1232 CDD:238060
LDLa 1243..1279 CDD:238060
LDLa 1283..1318 CDD:238060
LDLa 1340..1371 CDD:197566
FXa_inhibition 1388..1416 CDD:291342
EGF_CA 1418..1452 CDD:214542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000315
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.