DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LDLR and LpR1

Sequence 1:NP_000518.1 Gene:LDLR HGNCID:6547 Length:860 Species:Homo sapiens
Sequence 2:NP_001097934.2 Gene:LpR1 FlyBaseID:FBgn0066101 Length:1076 Species:Drosophila melanogaster

Alignment Length:847 Identity:331/848 (39%)
Similarity:481/848 (57%) Gaps:56/848 (7%)


Human    27 CERNEFQCQD-GKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCD 90
            |..|||:||. .:||...|:||||.:|:|.|||:.  |.:.||...:::|.....:|:|..|.||
  Fly   219 CPNNEFKCQTVDQCIPRSWLCDGSNDCRDKSDEAH--CRARTCSPDEYACKSGEGQCVPLAWMCD 281

Human    91 GQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTC-GPASFQ 154
            ...||.:||||..| .:||..|||.|.:|:||.:::.||.|.||.|||||..|||:.| ..|...
  Fly   282 QSKDCSDGSDEHNC-NQTCRADEFTCGNGRCIQKRWKCDHDDDCGDGSDEKECPVVPCDSVAEHT 345

Human   155 CNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSG-ECIHSSWRCDG 218
            |.:..||.:.|.||.||||.|||||  :.|..:   ...::||.:.|:.|... .|:|.||.|||
  Fly   346 CTNGACIAKRWVCDGDPDCSDGSDE--RSCANV---TKTTTPCLSHEYQCKDRITCLHHSWLCDG 405

Human   219 GPDCKDKSDEE--NCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGC-------VNVT 274
            ..||.|..||.  ||...|||.|:|||.|.:||.|...|:.:.||.|.|||..|       :|..
  Fly   406 DRDCPDGDDEHTANCKNVTCRADQFQCGDRSCIPGHLTCNGDKDCADGSDERDCGLSLSLGINQG 470

Human   275 LCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECL 339
            .|...::|.|..|:|:.|.|||:..:||.|..|||..:||.|||...||||.|.|.|||:|:.|.
  Fly   471 GCNATSEFDCGGGQCVPLSKVCDKRKDCPDGEDEPAGKCGINECASKNGGCMHQCIDLKVGHHCE 535

Human   340 CPDGFQLVAQRR-CEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDP--HTKACKAVGSIAYL 401
            |.:|::|...:| |:||:||:.|..|||:|||..||:||:||.|:..||  ||: |||....|.|
  Fly   536 CHEGYKLSPDKRNCQDINECEVPGKCSQICVNEIGGFKCECEAGYMRDPKNHTR-CKASEGHASL 599

Human   402 FFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYD 466
            ....||::||:.||..|.||::.:.:...|||....:..|:|||::.:.|....:|..   :...
  Fly   600 LLARRHDIRKIALDHMEMTSIVNSTKAATALDFVFRTGMIFWSDVTTQSIYKAPIDEG---NEKT 661

Human   467 TVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFM 531
            .|:::.....||||||||::::|:||:...|:.:.:.:|...|.|.:::...||:|.:||:.|:|
  Fly   662 VVLTKSSVTSDGLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVKDSLDIPRSIALDPIEGWM 726

Human   532 YWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRK 596
            ||:|||...:|::.|::|....::::.:::|||||||||:..|:||||.||:.|||.:.:|..|.
  Fly   727 YWSDWGASPRIERAGMDGSHRTTIISYDVKWPNGITLDLVKKRIYWVDGKLNVISSANYDGSQRS 791

Human   597 TILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVN-LLAENLLS-PEDMVLFHNLT 659
            .:|...:.|.||||:..|||.|:|||...:|:|.||:.||.||. :.|.::|. |..:.::|...
  Fly   792 QVLYSGEYLRHPFSITTFEDNVYWTDWDKQAVFKANKFTGEDVEPVTAMHMLQHPMVVHVYHPYR 856

Human   660 QPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSC---------LTEA 715
            ||.|||.|:..   ||.|.:||||||:||..||:.:||||.|:.|..|...|         :|..
  Fly   857 QPDGVNHCQSV---NGHCSHLCLPAPRINERSPRISCACPTGLKLMVDGLMCVEDPLYLPPVTRP 918

Human   716 EAAVATQETSTVRLKVSSTAVRTQHTTTR-PVPDTSRLPGATPGLTTVEIV----TMSHQALGDV 775
            ..|..|:.......:...|.|:..|...| .:.|..:|....|.|.|..:.    ..:|..: :.
  Fly   919 PRARKTKPRPKSPRRRLPTGVQVGHADIRIEINDDLQLSTRLPLLPTTFVADQRPVKNHTQI-EK 982

Human   776 AGRGNEKKPSSVRALSIV-----LPIVLLVFLCLGVFLLWKNWRLKNINSINFDNPVYQKTTEDE 835
            ....:|:..|...||.::     ..::|.|.|.:|    ::....:.|||:||:||:|:|||..|
  Fly   983 TTTPSEQPDSGFIALVVIASLSGFAVLLSVLLLIG----YRYCSKRRINSMNFENPIYRKTTTTE 1043

Human   836 VH 837
            .|
  Fly  1044 DH 1045

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LDLRNP_000518.1 Ldl_recept_a 25..58 CDD:278486 17/32 (53%)
Ldl_recept_a 66..104 CDD:278486 14/38 (37%)
Ldl_recept_a 107..143 CDD:278486 19/36 (53%)
Ldl_recept_a 147..179 CDD:278486 16/33 (48%)
Ldl_recept_a 195..231 CDD:278486 17/39 (44%)
Ldl_recept_a 235..270 CDD:278486 18/35 (51%)
LDLa 278..308 CDD:294076 12/30 (40%)
FXa_inhibition 318..>346 CDD:291342 14/28 (50%)
EGF_CA 354..388 CDD:214542 20/36 (56%)
LDL-receptor class B 1 397..438 14/41 (34%)
LY 419..457 CDD:214531 10/38 (26%)
LDL-receptor class B 2 439..485 15/46 (33%)
Ldl_recept_b 439..482 CDD:278487 12/43 (28%)
LDL-receptor class B 3 486..528 12/42 (29%)
Ldl_recept_b 487..525 CDD:278487 10/38 (26%)
LDL-receptor class B 4 529..572 19/43 (44%)
Ldl_recept_b 529..569 CDD:278487 17/40 (43%)
LY 553..595 CDD:214531 20/42 (48%)
LDL-receptor class B 5 573..615 19/42 (45%)
LDL-receptor class B 6 616..658 17/44 (39%)
Ldl_recept_b 616..655 CDD:278487 16/41 (39%)
FXa_inhibition 671..711 CDD:291342 20/40 (50%)
Clustered O-linked oligosaccharides 721..768 10/52 (19%)
Required for MYLIP-triggered down-regulation of LDLR. {ECO:0000269|PubMed:19520913} 811..860 13/28 (46%)
NPXY motif. {ECO:0000269|PubMed:22509010} 823..828 3/5 (60%)
LpR1NP_001097934.2 LDLa 135..167 CDD:197566
LDLa 178..210 CDD:197566
LDLa 219..254 CDD:238060 18/37 (49%)
LDLa 259..295 CDD:238060 13/36 (36%)
LDLa 343..373 CDD:238060 15/32 (47%)
LDLa 383..415 CDD:197566 14/32 (44%)
Ldl_recept_a 423..459 CDD:278486 18/36 (50%)
LDLa 476..504 CDD:197566 12/28 (43%)
FXa_inhibition 514..549 CDD:291342 16/35 (46%)
EGF_CA 551..581 CDD:214542 18/30 (60%)
LY 662..702 CDD:214531 14/40 (35%)
LY 704..747 CDD:214531 17/43 (40%)
LY 749..790 CDD:214531 20/41 (49%)
FXa_inhibition 864..905 CDD:291342 21/44 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 713 1.000 Inparanoid score I631
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D179614at33208
OrthoFinder 1 1.000 FOG0000315
OrthoInspector 1 1.000 T130091
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24270
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R7933
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
99.110

Return to query results.
Submit another query.