DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and Cul4a

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_666319.2 Gene:Cul4a MGIID:1914487 Length:759 Species:Mus musculus

Alignment Length:753 Identity:164/754 (22%)
Similarity:290/754 (38%) Gaps:162/754 (21%)


  Fly    30 DDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSDCLMKRLKNI------AWVME 88
            |:||....:||......|....:...|.....|.........:|..|.|:|:.:      |.::.
Mouse    56 DNYTQDTWRKLHEAVKAIQSSTSIRYNLEELYQAVENLCSHKVSPTLYKQLRQVCEDHVQAQILP 120

  Fly    89 NQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGDKETYPIYRLAMISWKE 153
            .:.|....:..:.|....|..:.|....:.......:|.:|.:..:...     |:.:.:..::.
Mouse   121 FREDSLDSVLFLKKINTCWQDHCRQMIMIRSIFLFLDRTYVLQNSMLPS-----IWDMGLELFRN 180

  Fly   154 LVFEPSVTILAAIRLILSQMPRE-----YNKSL---------EYQVY------QVLQSIVELYAN 198
            .:....:.....|..||..:.||     .::||         :.|||      :.|:....|||.
Mouse   181 HIISDRMVQSKTIDGILLLIGRERSGEAVDRSLLRSLLSMLSDLQVYKDSFELKFLEETNCLYAA 245

  Fly   199 D---KYQDVSLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVSNDYKDFKHFLRYACLAMPEIENGT 260
            :   ..||..:|..::.:  .|.::       .|..:::...|:...|..:  ||:....:  |.
Mouse   246 EGQRLMQDREVPEYLNHV--SKRLE-------EEADRVITYLDHSTQKPLI--ACVEKQLL--GE 297

  Fly   261 QFKAILKRYLAARLQETRLSGKDYIQAFLGLCRGPLQRALRDH---------------------- 303
            ...|||::.|...|.|.|:.....:.......:|. |.||..|                      
Mouse   298 HLTAILQKGLEHLLDENRVPDLTQMYQLFSRVKGG-QHALLQHWSEYIKTFGTTIVINPEKDKDM 361

  Fly   304 --------TKLAEVVDAVC-----------KEE----INRKGQIIDPTRLLVTYANELMTKRQES 345
                    .|:..||: ||           ||.    ||::..  .|..|:..:.:..:  |..:
Mouse   362 VQDLLDFKDKVDHVVE-VCFQRNERFINLMKESFETFINKRPN--KPAELIAKHVDSKL--RAGN 421

  Fly   346 EEAIIDELKRIVKCVEFLSDEYKFID-------MYLKALRIRQINETSTSDGVESIMYSLLNKKM 403
            :||..:||:||:..:..|   ::||.       .|.|.|..|.:...|.|...|..|.|.|..:.
Mouse   422 KEATDEELERILDKIMIL---FRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHEC 483

  Fly   404 ANFVTRCIYVQLRDVDKLRTLKKEFQDHLNSKGIK---------LGFDFRPKCFKNDGSFENFNL 459
            ....|..:....:|::..:.:...|:.|:.::...         |...:.|       ::....:
Mouse   484 GAAFTSKLEGMFKDMELSKDIMVHFKQHMQNQSAPGPIDLTVNILTMGYWP-------TYTPMEV 541

  Fly   460 TLPDELQQAWKEFRIFY----EARKLQSKAIIQLNNELSSGEITCHLNQSVYILEVSTLQMAVLM 520
            .||.|:.:..:.|:.||    ..|||      |....|....:.....:.....:||..|..||:
Mouse   542 HLPPEMVRLQEVFKTFYLGKHSGRKL------QWQTTLGHAVLKADFKEGKKEFQVSLFQTLVLL 600

  Fly   521 LFNRHERFTEQELVTALGVELETLQEALKQI---KFLVYIEVNKVNYIE------INMDFTNRKR 576
            :||..:.|:.:|:..|.|:|...|:..|:.:   |..|.|:..|...:|      .|.||.::..
Mouse   601 MFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNADFKHKLF 665

  Fly   577 RLFCNEPLPRKMRKIEEKSEIELKIR--------RDKQVDAAIVRIMKGQKQLEYSELISLVYEE 633
            |:        |:.:|:.|..:|.::.        |..|:|||||||||.:|.|.::.|:|.:|.:
Mouse   666 RI--------KINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQ 722

  Fly   634 LKDRVKPQVSFIKKRLDYLVEREYLERD-NYYNIYRYL 670
            ||..|||  ..:|||::.|::|:|:||| :..|.|.|:
Mouse   723 LKFPVKP--GDLKKRIESLIDRDYMERDKDSPNQYHYV 758

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 164/752 (22%)
CULLIN 362..500 CDD:214545 30/158 (19%)
Cullin_Nedd8 606..661 CDD:287520 28/55 (51%)
Cul4aNP_666319.2 Cullin 65..659 CDD:279260 121/634 (19%)
CULLIN 442..582 CDD:214545 29/153 (19%)
Cullin_Nedd8 688..753 CDD:214883 30/67 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.