DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and RTT101

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_012488.3 Gene:RTT101 SGDID:S000003583 Length:842 Species:Saccharomyces cerevisiae

Alignment Length:893 Identity:163/894 (18%)
Similarity:289/894 (32%) Gaps:317/894 (35%)


  Fly    20 NILQVVNQIFDD----YTSFDGQKLMHLYHLIYKQCAAERNW------NNPAQKNGRSLYIVLSD 74
            |.|.:.|:..|:    |.:...: |...:||...:...|.:.      ...|.|..:.:..:|::
Yeast    24 NALGLYNKFNDERNPRYRTMIAE-LHEFFHLTLAETITETDVKELECNKEKAAKFRKLMPKMLNN 87

  Fly    75 C--LMKRLKNIAWVMENQLDDNKPIRLIAKYLEHWV--PYQRSCEKLN------------LAC-Y 122
            |  |.:|...|.:..|...:|.|..:....: :|.:  .:|..|::|.            ..| |
Yeast    88 CRELTQRKSYIPYNSEFNGNDEKQKKFQLLH-QHQIVLSFQEFCDELAKLIIDAHVLSFLTRCDY 151

  Fly   123 HFN---RNWVERERLKGDKETYPIYRLAMISWKELVFEPSVTILAAIRLILSQMPREY---NKSL 181
            .:.   :||..            .|:|...            ::.|:..|:|.:|..|   .|.|
Yeast   152 SYEIIPKNWTS------------FYKLFQY------------VMGAVGPIISYVPVNYPMIRKEL 192

  Fly   182 EYQVYQVLQSIVELYANDKYQDVSLPSRIDKIFTEKVMDFYKSTTLHEFQKI------------- 233
            .::...:.|     |.:.|..: .:.|...:.|:..|     |.|:|.:..:             
Yeast   193 GFETLTIFQ-----YYDSKLFE-CMKSHFGREFSTLV-----SATIHHYIHMFPITNTMLEKEVP 246

  Fly   234 ---VVSN--------DYKDF--KHFLRYAC---LAMPEIENGTQFKAILKR-------------- 268
               ::||        ..|||  |...:|.|   ...|.:|....||.:|.|              
Yeast   247 MLRIMSNCNFSIEGLSPKDFYMKTLRQYYCEESNLRPRLETFKNFKVLLTRNALLASLFSPEWVS 311

  Fly   269 ----YLAARLQETRLSGKDYIQAFLGLCRGPLQRALRDHTKLAEVV--------------DAVCK 315
                ...:.|...:.|..:||:..........:|..:..|..:.::              ...|.
Yeast   312 DANDLFISHLLLNKKSISEYIEIGKDTYDEEKERYFKTETHFSLLMFRNAFEAKNMLSKFKEFCD 376

  Fly   316 EEINRKGQIIDPTRLLVTYANELMTKRQESEE---AIIDELKRIVKCVEF-----LSDEYKFIDM 372
            :.::.|        |...|.:...|:|...|.   |.:|.||.....:|:     |....|.|:.
Yeast   377 DAVSEK--------LKAAYGSNHDTERLFDEVVQLANVDHLKIYSDSIEYHLCNLLGSTSKAIEQ 433

  Fly   373 YLKALR------IRQINETSTSDGVESIMYSLLNKKM-------------ANFVTRCIYVQ---- 414
            |:|...      :|:| :|:..|....:....||:.:             .||..|.|:.:    
Yeast   434 YVKYFESHLFIIVRKI-KTTKKDLPRDMKIKYLNENLPILRLKFVNLPTFPNFFERSIFRKTILQ 497

  Fly   415 -------LRDV-----DKLRTLKK-----------------EFQDHL------------------ 432
                   ::|:     |.|..|.|                 ::|.:|                  
Yeast   498 SDQNSSFIKDILPVYKDSLMELFKQRIITNVSQEDEMRYRDQYQPYLSQFFQPVEVMADLRIKYA 562

  Fly   433 ----------------------NSKG-IKLGFDFR--PKCFKNDGSFENFNLTLPDELQQAWKEF 472
                                  |||. ..|.||..  ||.|:.....:. |..||.|:...|.:|
Yeast   563 SFLSFYENIEAAVKFGKTYNENNSKSFFPLIFDRERIPKVFQQSNEVKK-NFVLPQEMDDTWNQF 626

  Fly   473 -RIFYEARKLQSKAIIQLNNELSSGEI-------TCHLNQSVYIL--------EVSTLQMAVLML 521
             |.::|..|::       :::.|..|:       .|.: :|.||:        |::..|..||.|
Yeast   627 LRNYHEQNKVE-------DSDASKKELYPMWNLHHCEV-ESPYIIQDGTNLIFELTLFQTCVLTL 683

  Fly   522 FNRHERFTEQELVTALGVELETLQEALK-QIKFLVYIEVNKVNYIEINMDFTNRKRRLFCNEPLP 585
            ||..:..|           |:.:.|..| ..|.|..:..:..||..:..|..|   ....||...
Yeast   684 FNESDHLT-----------LQVISEQTKLAYKDLALVLKSFCNYKILTRDIDN---TYSINESFK 734

  Fly   586 RKMRKIEEKSEIELKIRR---------------------------DKQVDAAIVRIMKGQKQ-LE 622
            ..|:|: :..::.:.:.|                           .:.:.|.|.|.:|.::. |:
Yeast   735 PDMKKV-KNGKLRVVLPRTASLQSSNTGGERTSSAHHEGSNSQWTQELLKACITRSVKSERNGLD 798

  Fly   623 YSELISLVYEELKDRVKP-QVSFIKKRLDYLVEREYLERDNYYNIYRY 669
            |..|    :|.:|.::|. .|...|..|..|:..:::.||.....|:|
Yeast   799 YDHL----FETVKQQIKGFSVGEFKDALAKLLRDKFITRDESTATYKY 842

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 161/889 (18%)
CULLIN 362..500 CDD:214545 42/246 (17%)
Cullin_Nedd8 606..661 CDD:287520 15/57 (26%)
RTT101NP_012488.3 Cullin_Nedd8 776..836 CDD:299553 16/64 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.