DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and CUL3

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_011517.1 Gene:CUL3 SGDID:S000003235 Length:744 Species:Saccharomyces cerevisiae

Alignment Length:775 Identity:152/776 (20%)
Similarity:297/776 (38%) Gaps:188/776 (24%)


  Fly    19 DNILQVVNQIFDD---YTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSDCLMKRL 80
            :.:...::.|:.|   ..||:     .:|..||         .....|.|..||..|.|.|:::|
Yeast    27 ETVKYAIDHIYSDDMADLSFE-----QVYKTIY---------TIVLNKKGPILYNRLKDYLIQKL 77

  Fly    81 KNIAWVMENQLDDN-KPIRLIAKYLEHWVPYQRSCEKL--NLACYHFNRNWVERERLKGDK--ET 140
               |.:.|..:.|| .....:......| ..|..|.|:  :|..|      :::...|.::  |.
Yeast    78 ---ALLRETIVKDNTHDYEFLGTMARLW-EVQCHCFKITGDLMMY------MDKVYCKPNRCMEV 132

  Fly   141 Y----PIYRL------------AMIS------------------WKELV---------------- 155
            |    .::|:            |:||                  ||.|:                
Yeast   133 YDMCLDLFRIEILQKCSSSLISALISDIERIRNLGSVDSEHTSLWKVLIGMMETLHDNRDSFFLT 197

  Fly   156 -FEPSVTILAAIRLILSQMPREYNKSLEYQVYQVLQSI--------VELYANDKYQDVSLPSRID 211
             |||         :::|.....|||:::.::...::|:        .|...:..:.:|...:::.
Yeast   198 DFEP---------VLISATEEYYNKAIDIELLTPIESLEKIRKLRQFESMLDSSFLNVDSHNKLK 253

  Fly   212 KIFTE-----KVMDFYKSTTLHEFQKIVVSND-------------------YKDFKHFLRYACLA 252
            .:...     |:.|..:..| ||  .:|:||.                   .:..|.::....:.
Yeast   254 TVLENVLIWGKLSDIIEDLT-HE--AMVISNGKLLQEIYDLSSEEKYRVTVIESIKSYINKNAIN 315

  Fly   253 MPEIENG--------TQFKAILKRYLAARLQETRLSGKDYIQAFLGLCRGPLQRALRDHTKLAEV 309
            :|..|..        |....|::.|   |.|.:.|...|:....|....|.:..|:     |.:|
Yeast   316 IPFNEGNRKKGQNAITWSSEIVELY---RSQHSFLESIDFGSVRLNNLTGDVSNAI-----LGDV 372

  Fly   310 VDAVCKEEINRKGQIIDPTRLLVTYANELMTKRQESEEAII---DELKRIVKCVEFLSDEYKFID 371
            ....    .:::|.:  |:..|.||.:..|.:.:|.:..|:   .:|....|.:..|:::..|..
Yeast   373 FSMY----FSKEGAL--PSEYLSTYVDHCMKRTKEKDAEIVKIKQDLLDSTKLIGLLTEKDIFEK 431

  Fly   372 MYLKALRIRQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRTLKKEFQDHLNSKG 436
            :|.|.|..|.:.:.|..: :|..|..::.|.:..|.|..:.:.|||:.....:.:.|| |.....
Yeast   432 IYKKQLSRRLLQQRSLVE-IEKWMVQMIKKVLGTFFTSKLEIMLRDISLSSEMYQAFQ-HSTINS 494

  Fly   437 IKLGFDFRPKCF-KNDGSFENFN-----LTLPDELQQAWKEFRIFYEARKLQSKAIIQLNNELSS 495
            |:. ..|.|:.. :....|::.|     ::||..:.|....|..:|..:  ..:.:::..:.||.
Yeast   495 IEY-LSFAPQVLTRTSWPFQSTNPIDEGISLPPRMSQILAGFEGYYSLK--YKERVLKWAHHLSV 556

  Fly   496 GEITCHLNQSVYILEVSTLQMAVLMLFNRHERFTEQELVTALGVELETLQEALKQIKFLVYIEVN 560
            .||.|..|...|.:..|.....:.:||..:|..|..|:.....:.::.::..:..:..:...::.
Yeast   557 IEIGCQFNSGYYEISFSVYAGVIFLLFEDYEELTLGEIYELTHIPIDDVKSLVMSMSTIPRCKIL 621

  Fly   561 KVNYIEINMDFT--------NRKRR---LFCNEPLP-RKMRKIEEKSEIELKIRRDKQV----DA 609
            |.:....||.|:        |||.:   :.|  ||| :|...:...|.::   ..|.::    .|
Yeast   622 KKSSSSGNMKFSVNYFFSSPNRKVKVPVIAC--PLPSQKSDNLATASSVD---TYDNEIVMELSA 681

  Fly   610 AIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIKKRLDYLVEREYLERD----NYYN 665
            .||||||.:.:|.:.:|:....:..:.|:....|.:|:.:..|:|:||::|:    :||:
Yeast   682 IIVRIMKTEGKLSHQQLLERTTKRTQSRLSLTPSILKRSIQLLIEKEYIQRNADDPSYYH 741

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 152/770 (20%)
CULLIN 362..500 CDD:214545 32/144 (22%)
Cullin_Nedd8 606..661 CDD:287520 17/59 (29%)
CUL3NP_011517.1 COG5647 1..744 CDD:227934 152/776 (20%)
CULLIN 423..563 CDD:214545 33/145 (23%)
Cullin_Nedd8 676..738 CDD:214883 17/62 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.