DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and CDC53

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_010150.1 Gene:CDC53 SGDID:S000002290 Length:815 Species:Saccharomyces cerevisiae

Alignment Length:822 Identity:168/823 (20%)
Similarity:315/823 (38%) Gaps:205/823 (25%)


  Fly    25 VNQIFDD-----------YTSFDGQKLMHLYHLIYKQCAAERNWN---NPAQKNGRSLYIVLSDC 75
            :|||..:           |........|.:|..||..|..:...:   :...:.|:|..:|.|: 
Yeast    22 INQILGNEKNQASTSKRVYKILSPTMYMEVYTAIYNYCVNKSRSSGHFSTDSRTGQSTILVGSE- 85

  Fly    76 LMKRLKNIAWVMENQLDDNKPIR---LIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGD 137
            :.::|||   .::|.:.:.|...   .:..|::.|..:......||.|..:.||.||::||..|.
Yeast    86 IYEKLKN---YLKNYILNFKQSNSETFLQFYVKRWKRFTIGAIFLNHAFDYMNRYWVQKERSDGK 147

  Fly   138 KETYPIYRLAMISWKELVFEPSVTILAAIRLILSQM---------------------------PR 175
            :..:.:..|.:::|||::|:||..:|  |..:|.|:                           |:
Yeast   148 RHIFDVNTLCLMTWKEVMFDPSKDVL--INELLDQVTLGREGQIIQRSNISTAIKSLVALGIDPQ 210

  Fly   176 EYNKSLEYQVY-QVL--------QSIVELYANDKYQDVSLPSRIDKIF-----TEKVMDFY---- 222
            :. |.|...|| ||.        |.....|.||..:..|:...|.:..     .||.|..|    
Yeast   211 DL-KKLNLNVYIQVFEKPFLKKTQEYYTQYTNDYLEKHSVTEYIFEAHEIIKREEKAMTIYWDDH 274

  Fly   223 -KSTTLHEFQKIVVSNDYKDFKH-FLRYACLAMPEIENGTQFKAILKR--------------YL- 270
             |........|:::::..:..:: |:  ..|...:||..|...|:::|              |: 
Yeast   275 TKKPLSMALNKVLITDHIEKLENEFV--VLLDARDIEKITSLYALIRRDFTLIPRMASVFENYVK 337

  Fly   271 ----------------------------AARLQETRLSGKDYIQAFL---GLCRGPLQRALRDHT 304
                                        .|.:....||.||||:..|   .:.......:..|..
Yeast   338 KTGENEISSLLAMHKHNIMKNENANPKKLALMTAHSLSPKDYIKKLLEVHDIFSKIFNESFPDDI 402

  Fly   305 KLAEVVDAVCKEEIN----------RKGQIIDPTRLLVTYANELMTKRQESEEAIIDELKRIVKC 359
            .||:.:|..|...||          .|......:.:|..|::.|:.|..:.|.|.....:.|:..
Yeast   403 PLAKALDNACGAFININEFALPAGSPKSATSKTSEMLAKYSDILLKKATKPEVASDMSDEDIITI 467

  Fly   360 VEFLSDEYKFIDMYLKALRIRQINETSTS-DGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRT 423
            .::|:|:..|...|.:....|.|:.|||| :..|:|:..|   :.||           .::....
Yeast   468 FKYLTDKDAFETHYRRLFAKRLIHGTSTSAEDEENIIQRL---QAAN-----------SMEYTGK 518

  Fly   424 LKKEFQDHLNSKGIKLGF----------------DFRPKCFKND---GSFENFNLTLPDELQQAW 469
            :.|.|||...||.::..|                |.:|.....:   .|::.....||.||..:.
Yeast   519 ITKMFQDIRLSKILEDDFAVALKNEPDYSKAKYPDLQPFVLAENMWPFSYQEVEFKLPKELVPSH 583

  Fly   470 KEFRIFYEARKLQSKAIIQLNNELSSGEITCHL---NQSVYILEVSTLQMAVLMLFNRHERFTEQ 531
            ::.:..|..:  .:..|::....|..||:...:   .:..:...|:..|||:|:|:|..:..|.:
Yeast   584 EKLKESYSQK--HNGRILKWLWPLCRGELKADIGKPGRMPFNFTVTLFQMAILLLYNDADVLTLE 646

  Fly   532 ELVTALGVELETLQEALKQ-IKFLVYIEV-----------------NKVNYIEINMDFTNRKRRL 578
            .:.....:.::.:..|:.. |||.:..:|                 .....::.|::|.:..:  
Yeast   647 NIQEGTSLTIQHIAAAMVPFIKFKLIQQVPPGLDALVKPETQFKLSRPYKALKTNINFASGVK-- 709

  Fly   579 FCNEPLP-----------RKM--RKIEEKSEIELKIRRDKQV--DAAIVRIMKGQKQLEYSELIS 628
              |:.|.           .|:  :::.|...||.::..::|:  :|.||||||.::.|.::.|::
Yeast   710 --NDILQSLSGGGHDNHGNKLGNKRLTEDERIEKELNTERQIFLEACIVRIMKAKRNLPHTTLVN 772

  Fly   629 LVYEELKDRVKPQVSFIKKRLDYLVEREYLERDNYYNIYRYL 670
            ....:...|...:||.:|:.:|.|:::.||:|.:....|.||
Yeast   773 ECIAQSHQRFNAKVSMVKRAIDSLIQKGYLQRGDDGESYAYL 814

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 167/821 (20%)
CULLIN 362..500 CDD:214545 34/158 (22%)
Cullin_Nedd8 606..661 CDD:287520 19/57 (33%)
CDC53NP_010150.1 COG5647 7..815 CDD:227934 168/823 (20%)
CULLIN 470..614 CDD:214545 34/160 (21%)
Cullin_Nedd8 743..810 CDD:214883 19/67 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C241606283
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1033
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.840

Return to query results.
Submit another query.