DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and CUL1

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001357589.1 Gene:CUL1 HGNCID:2551 Length:776 Species:Homo sapiens

Alignment Length:783 Identity:204/784 (26%)
Similarity:348/784 (44%) Gaps:161/784 (21%)


  Fly    25 VNQIFDD--------YT--SFDGQKLMHLYHLIYKQCAAERNWNN------PAQKN--------- 64
            ::||:||        ||  |....:.|.||..:|..|.:....|.      |..|:         
Human    17 LDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPGGA 81

  Fly    65 ---GRSLYIVLSDCLMKRLKNIAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNR 126
               |..||..|.:.|...|.|:....|:.:|::    ::..|.:.|..|:.|.:.||..|.:.||
Human    82 QFVGLELYKRLKEFLKNYLTNLLKDGEDLMDES----VLKFYTQQWEDYRFSSKVLNGICAYLNR 142

  Fly   127 NWVERERLKGDKETYPIYRLAMISWKELVFEP---SVT--ILAAI-----------RLI------ 169
            :||.||..:|.|..|.||.||:::|::.:|.|   .||  :|..|           |||      
Human   143 HWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQS 207

  Fly   170 --------------------------------------------LSQMP-REYNKSLEYQVYQVL 189
                                                        |.|.| .||.|..|.::.:. 
Human   208 YVELGLNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEE- 271

  Fly   190 QSIVELYANDKYQDVSLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVSNDYKDFKHFLRYACLAMP 254
            |..|::|.::..|| .|..:.:::..||.::.:.:    |||.::.::..:|......    .:.
Human   272 QRRVQVYLHESTQD-ELARKCEQVLIEKHLEIFHT----EFQNLLDADKNEDLGRMYN----LVS 327

  Fly   255 EIENGT-QFKAILKRY-----LAA--RLQETRLSG-KDYIQAFLGLCR---GPLQRALRDHTKLA 307
            .|::|. :.|.:|:.:     |||  :..|..|:. |.|:|..|.:.:   ..:..|..:.....
Human   328 RIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFV 392

  Fly   308 EVVDAVCKEEINRKG------QIIDPTRLLVTYANELMTKRQES-EEA-IIDELKRIVKCVEFLS 364
            ..:|..|...||...      .......||..|.:.|:.|..:: ||| :.|.|.:::...:::.
Human   393 AALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIE 457

  Fly   365 DEYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRTLKKEFQ 429
            |:..|...|.|.|..|.:::.|.||..|:.|.|.|.:......|..:....:|:...:.|.::|:
Human   458 DKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFK 522

  Fly   430 DHL-NSKGIKLGFDFRPKCFKNDGSF---ENFNLTLPDELQQAWKEFRIFYEARKLQSKAIIQLN 490
            .|| ||:.:.|.|..:   ..:.||:   ::....||.||:::::.|..||.:|....|  :...
Human   523 KHLTNSEPLDLDFSIQ---VLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRK--LTWL 582

  Fly   491 NELSSGEITCHLNQSVYILEVSTLQMAVLMLFNRHERFTEQELVTALGVELETLQEALK---QIK 552
            .:||.||:..:..::.|.|:.||.|||:|:.:|..:.:|.|:|..:..::::.|.:.|:   :.|
Human   583 YQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSK 647

  Fly   553 FLVYIEVN-KVNYIEINMD--------FTNRKRRLFCNEPLPRKMRKIEEKSEIEL---KIRRDK 605
            .||..:.| .|:.:|:..|        :.|:|.|:..|.|:     |.|:|.|.|.   .|..|:
Human   648 LLVLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPM-----KTEQKQEQETTHKNIEEDR 707

  Fly   606 Q--VDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIKKRLDYLVEREYLER-DNYYNIY 667
            :  :.||||||||.:|.|::.:|:..|..:|..|.||:|..|||.:|.|:|:||||| |...:.|
Human   708 KLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTY 772

  Fly   668 RYL 670
            .||
Human   773 SYL 775

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 203/782 (26%)
CULLIN 362..500 CDD:214545 38/142 (27%)
Cullin_Nedd8 606..661 CDD:287520 28/58 (48%)
CUL1NP_001357589.1 Cullin 21..660 CDD:334305 156/658 (24%)
Cullin_Nedd8 708..767 CDD:337788 29/59 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1033
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.