DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and CUL2

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:XP_011518045.1 Gene:CUL2 HGNCID:2552 Length:808 Species:Homo sapiens

Alignment Length:793 Identity:159/794 (20%)
Similarity:307/794 (39%) Gaps:182/794 (23%)


  Fly     1 MNRVKRISNYFDSMLPLIDNILQVV----------NQIFDDYTSFDGQKLMHLYHLIYKQCAAER 55
            |:...|:.::.::...|:..|..||          |..|.|               ||..|.|  
Human    64 MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSD---------------IYALCVA-- 111

  Fly    56 NWNNPAQKNGRSLYIVLSDCLMKRLKNI-AWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNL 119
             :..|.   |..||......|...:::: ..|:|::      .:::..|..:|..|.:..:.::.
Human   112 -YPEPL---GERLYTETKIFLENHVRHLHKRVLESE------EQVLVMYHRYWEEYSKGADYMDC 166

  Fly   120 ACYHFNRNWVERERLKGDKETY------------PIYRLAMISWKELVFEPSVTILAAIRLILSQ 172
            ...:.|..::::.:|......|            .|..||:..|::|:.||...||  ||::|.:
Human   167 LYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQAIL--IRMLLRE 229

  Fly   173 MP-----------------------REYNKSLEYQVYQVLQSIVELYANDKY--QDVS--LPSRI 210
            :.                       .:|.|....:.||.:.....|....:|  |:.|  |....
Human   230 IKNDRGGEDPNQKVIHGVINSFVHVEQYKKKFPLKFYQEIFESPFLTETGEYYKQEASNLLQESN 294

  Fly   211 DKIFTEKVMDFYK---------------STTLHEFQKIVVSNDYKDFKHFLRYAC--LAMPEIEN 258
            ...:.|||:...|               :..:||.|:.:|:    |...||...|  :...|.:|
Human   295 CSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVA----DHLQFLHAECHNIIRQEKKN 355

  Fly   259 GTQFKAILKRYLAARL----QE-------------TRLSGKDYIQAFLGLCRGPLQRALRDHTKL 306
            ......:|.|.::..|    ||             :.|:.::....|       ::..|..|.|.
Human   356 DMANMYVLLRAVSTGLPHMIQELQNHIHDEGLRATSNLTQENMPTLF-------VESVLEVHGKF 413

  Fly   307 AEVVDAVCKEE--------------INRK--GQIIDPTRLLVTYANELMTKRQE--SEEAIIDEL 353
            .::::.|...:              :|.:  ..:.....||..|.:.|:.|..:  :|..:.|.|
Human   414 VQLINTVLNGDQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDRL 478

  Fly   354 KRIVKCVEFLSDEYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQLRDV 418
            ...:...:::.|:..|...|.:.|..|.|:..|.|...|..|.:.|.:......|..::....|:
Human   479 TSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDM 543

  Fly   419 DKLRTLKKEFQDHLNSKG--IKLGFDFR---------PKCFKNDGSFENFNLTLPDELQQAWKEF 472
            .....|..:|.:.:.::.  |.||..|:         |.......:|     .:|.||:::.:.|
Human   544 SVSADLNNKFNNFIKNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTF-----AIPQELEKSVQMF 603

  Fly   473 RIFYEARKLQSKAIIQLNNELSSGEITCHLNQSVYILEVSTLQMAVLMLFNRHERFTEQELVTAL 537
            .:|| ::....:.:..| :.|.:||:..:.....|:..|:|.|||||:.||..|..:.:||..:.
Human   604 ELFY-SQHFSGRKLTWL-HYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDST 666

  Fly   538 GVELETLQEALKQIKFLVYIEVNKVNY------------IEINMDFTNRKRRLFCNEPLPRKMRK 590
            .:..:.|.:.:|.:     ::|..:|:            ..:||:|::::.:......:.:...:
Human   667 QMNEKELTKTIKSL-----LDVKMINHDSEKEDIDAESSFSLNMNFSSKRTKFKITTSMQKDTPQ 726

  Fly   591 IEEKSEIELKIRRDKQVDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIKKRLDYLVER 655
            ..|::...:...|...:.||||||||.:|.|.::.||..|..:.:.|..|.:|.|||.::.|:::
Human   727 EMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDK 791

  Fly   656 EYLER-----DNY 663
            :|:||     |.|
Human   792 QYIERSQASADEY 804

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 154/770 (20%)
CULLIN 362..500 CDD:214545 31/149 (21%)
Cullin_Nedd8 606..661 CDD:287520 23/60 (38%)
CUL2XP_011518045.1 Cullin 93..706 CDD:279260 125/665 (19%)
CULLIN 487..631 CDD:214545 31/151 (21%)
Cullin_Nedd8 735..802 CDD:214883 24/67 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.