DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and CUL3

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001244127.1 Gene:CUL3 HGNCID:2553 Length:774 Species:Homo sapiens

Alignment Length:818 Identity:169/819 (21%)
Similarity:290/819 (35%) Gaps:236/819 (29%)


  Fly    10 YFDSMLPLIDNILQVVNQIFDDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSD 74
            |.:|:..|:.|.:|.:.:..:...||:     .||...|...         ..|:|..||..|.:
Human    35 YVNSIWDLLKNAIQEIQRKNNSGLSFE-----ELYRNAYTMV---------LHKHGEKLYTGLRE 85

  Fly    75 CLMKRLKN-IAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGDK 138
            .:.:.|.| :...:.|.|::|    .:....:.|..:|.:...:.....:.:|.:|::..::.  
Human    86 VVTEHLINKVREDVLNSLNNN----FLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVEN-- 144

  Fly   139 ETYPIYRLAMISWKELVF---------------------EPSVTILAAIR------LILS----- 171
                :|.|.:|.:::.|.                     :..|....|||      :||.     
Human   145 ----VYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRS 205

  Fly   172 -----------QMPREY-----NKSLEYQVYQVLQSIVELYANDKYQDVSLPSRIDKIFTEKVMD 220
                       :|..|:     .|.|......|....||...|::.:.|.  ..:||...|.::.
Human   206 VYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEARINEEIERVM--HCLDKSTEEPIVK 268

  Fly   221 FYKSTTLHEFQKIVVSNDYKDFKHFLR------YACL--AMPEIENGTQFKAILKRYLAARLQET 277
            ..:...:.:..|.:|..:.....|.|:      ..|:  ....:.||      ||..........
Human   269 VVERELISKHMKTIVEMENSGLVHMLKNGKTEDLGCMYKLFSRVPNG------LKTMCECMSSYL 327

  Fly   278 RLSGK-------------DYIQAFLGL---------------------------------CRGPL 296
            |..||             ||||..|.|                                 .|.|.
Human   328 REQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLLESFNNDRLFKQTIAGDFEYFLNLNSRSPE 392

  Fly   297 QRALRDHTKLAEVVDAVCKEEINRKGQIIDPTRLLVTYANELMTKRQESEEAIIDELKRIVKCVE 361
            ..:|....||.:.|..:.::|:                            |.|:|:...:.:   
Human   393 YLSLFIDDKLKKGVKGLTEQEV----------------------------ETILDKAMVLFR--- 426

  Fly   362 FLSDEYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRTLKK 426
            |:.::..|...|.:.|..|.:...|.||..|..|.|.|..:.....|..:....||:....|...
Human   427 FMQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNTTMD 491

  Fly   427 EFQDHLNSKGIKL-GFDF---------------RPKCFKNDGSFENFNLTLPDELQQAWKEFRIF 475
            ||:.||.:.|:.| |.|.               .|||            .:|...:.|::.||.|
Human   492 EFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKC------------NIPPAPRHAFEIFRRF 544

  Fly   476 YEARKLQSKAIIQLNNELSSGEITCHL----------------------NQSVYILEVSTLQMAV 518
            |.|:  .|...:.|.:.:.|.::....                      |...:||:|||.||.:
Human   545 YLAK--HSGRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTI 607

  Fly   519 LMLFNRHERFTEQELVTALGVELETLQEALKQI-----------KFLVYIEVNKVNYIEINMDFT 572
            |||||..|::|.:|:.....:....|..||:.:           |.....|:...:...:|..||
Human   608 LMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFT 672

  Fly   573 NRKRRLFCNEPLPRKMRKIEEKSEIELKIRRDK--QVDAAIVRIMKGQKQLEYSELISLVYEELK 635
            ::..|:.......::.....|:.|...|:..|:  :::||||||||.:|:::::.|::.|.::||
Human   673 SKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLK 737

  Fly   636 DRVKPQVSFIKKRLDYLVEREYLER---DNYYNIYRYL 670
            .|..|....||||::.|:|||||.|   |.  .:|.|:
Human   738 ARFLPSPVVIKKRIEGLIEREYLARTPEDR--KVYTYV 773

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 164/802 (20%)
CULLIN 362..500 CDD:214545 37/154 (24%)
Cullin_Nedd8 606..661 CDD:287520 26/58 (45%)
CUL3NP_001244127.1 Cullin 41..670 CDD:279260 131/706 (19%)
CULLIN 427..569 CDD:214545 37/156 (24%)
Cullin_Nedd8 706..766 CDD:287520 26/60 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.