DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and CUL4A

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001008895.1 Gene:CUL4A HGNCID:2554 Length:759 Species:Homo sapiens

Alignment Length:759 Identity:167/760 (22%)
Similarity:295/760 (39%) Gaps:174/760 (23%)


  Fly    30 DDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSDCLMKRLKNI------AWVME 88
            |:||....:||......:....:...|.....|.........:|..|.|:|:..      |.::.
Human    56 DNYTQDTWRKLHEAVRAVQSSTSIRYNLEELYQAVENLCSHKVSPMLYKQLRQACEDHVQAQILP 120

  Fly    89 NQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGDKETYP--------IYR 145
            .:.|....:..:.|....|..:.|....:.......:|.:|.:      ..|.|        ::|
Human   121 FREDSLDSVLFLKKINTCWQDHCRQMIMIRSIFLFLDRTYVLQ------NSTLPSIWDMGLELFR 179

  Fly   146 LAMISWKELVFEPSVTILAAIRLILSQ-----MPREYNKSL-----EYQVY------QVLQSIVE 194
            ..:||.|.:   .|.||...:.||..:     :.|...:||     :.|||      :.|:....
Human   180 THIISDKMV---QSKTIDGILLLIERERSGEAVDRSLLRSLLGMLSDLQVYKDSFELKFLEETNC 241

  Fly   195 LYAND---KYQDVSLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVSNDYKDFKHFLRYACLAMPEI 256
            |||.:   ..|:..:|..::.:  .|.::       .|..:::...|:...|..:  ||:....:
Human   242 LYAAEGQRLMQEREVPEYLNHV--SKRLE-------EEGDRVITYLDHSTQKPLI--ACVEKQLL 295

  Fly   257 ENGTQFKAILKRYLAARLQETRLSGKDYIQAFLGLCRGPLQRALRDH------------------ 303
              |....|||::.|...|.|.|:.....:.......||. |:||..|                  
Human   296 --GEHLTAILQKGLDHLLDENRVPDLAQMYQLFSRVRGG-QQALLQHWSEYIKTFGTAIVINPEK 357

  Fly   304 ------------TKLAEVVDAVCKEEINRKGQIIDPTRLLVTYAN-------ELMTKRQES---- 345
                        .|:..|:: ||.::..|...::..:  ..|:.|       ||:.|..:|    
Human   358 DKDMVQDLLDFKDKVDHVIE-VCFQKNERFVNLMKES--FETFINKRPNKPAELIAKHVDSKLRA 419

  Fly   346 --EEAIIDELKR----IVKCVEFLSDEYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNKKMA 404
              :||..:||:|    |:....|:..:..|...|.|.|..|.:...|.|...|..|.|.|..:..
Human   420 GNKEATDEELERTLDKIMILFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECG 484

  Fly   405 NFVTRCIYVQLRDVDKLRTLKKEFQDHLNSKG-----------IKLGF--DFRPKCFKNDGSFEN 456
            ...|..:....:|::..:.:...|:.|:.::.           :.:|:  .:.|           
Human   485 AAFTSKLEGMFKDMELSKDIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTP----------- 538

  Fly   457 FNLTLPDELQQAWKEFRIFY----EARKLQSKAII---QLNNELSSGEITCHLNQSVYILEVSTL 514
            ..:.|..|:.:..:.|:.||    ..||||.:..:   .|..|...|:..         .:||..
Human   539 MEVHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKE---------FQVSLF 594

  Fly   515 QMAVLMLFNRHERFTEQELVTALGVELETLQEALKQI---KFLVYIEVNKVNYIE------INMD 570
            |..||::||..:.|:.:|:..|.|:|...|:..|:.:   |..|.|:..|...:|      .|.:
Human   595 QTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNGE 659

  Fly   571 FTNRKRRLFCNEPLPRKMRKIEEKSEIELKIR--------RDKQVDAAIVRIMKGQKQLEYSELI 627
            |.::..|:        |:.:|:.|..:|.::.        |..|:|||||||||.:|.|.::.|:
Human   660 FKHKLFRI--------KINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLV 716

  Fly   628 SLVYEELKDRVKPQVSFIKKRLDYLVEREYLERD-NYYNIYRYL 670
            |.:|.:||..|||  ..:|||::.|::|:|:||| :..|.|.|:
Human   717 SELYNQLKFPVKP--GDLKKRIESLIDRDYMERDKDNPNQYHYV 758

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 167/758 (22%)
CULLIN 362..500 CDD:214545 30/158 (19%)
Cullin_Nedd8 606..661 CDD:287520 28/55 (51%)
CUL4ANP_001008895.1 Cullin 65..657 CDD:307166 124/638 (19%)
Cullin_Nedd8 688..753 CDD:214883 30/67 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.