DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and CUL4B

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_003579.3 Gene:CUL4B HGNCID:2555 Length:913 Species:Homo sapiens

Alignment Length:755 Identity:169/756 (22%)
Similarity:307/756 (41%) Gaps:173/756 (23%)


  Fly    30 DDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSDCLMKRLKNI------AWVME 88
            ::||....|||......|....:.:.|.....|.........:|..|.|:|:.|      |.:.:
Human   210 ENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQ 274

  Fly    89 NQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGDKETYP--------IYR 145
            .:.|....:..:.|....|..:.|....:.......:|.:|.:..:      .|        ::|
Human   275 FREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYVLQNSM------LPSIWDMGLELFR 333

  Fly   146 LAMISWKELVFEPSVTILAAIRLILSQMPREYN-----KSLEYQVYQVLQSIVELYAN-DKYQDV 204
            ..:||.:::   .:.||...:.||    .||.|     :||       |:|::.:.:: ..||| 
Human   334 AHIISDQKV---QNKTIDGILLLI----ERERNGEAIDRSL-------LRSLLSMLSDLQIYQD- 383

  Fly   205 SLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVSNDYKDFKHFL-------------------RYAC 250
                ..::.|.|:....|.:    |.||::...:..::.|.:                   :.:.
Human   384 ----SFEQRFLEETNRLYAA----EGQKLMQEREVPEYLHHVNKRLEEEADRLITYLDQTTQKSL 440

  Fly   251 LAMPEIE-NGTQFKAILKRYLAARLQETRLSGKDYIQAFLGLCRGPLQRAL-------------- 300
            :|..|.: .|....|||::.|...|.|.|:.....:.......||.:|..|              
Human   441 IATVEKQLLGEHLTAILQKGLNNLLDENRIQDLSLLYQLFSRVRGGVQVLLQQWIEYIKAFGSTI 505

  Fly   301 -----RDHTKLAEVVD---------AVC--KEE-------------INRKGQIIDPTRLLVTYAN 336
                 :|.|.:.|::|         .:|  |.|             ||::..  .|..|:..|.:
Human   506 VINPEKDKTMVQELLDFKDKVDHIIDICFLKNEKFINAMKEAFETFINKRPN--KPAELIAKYVD 568

  Fly   337 ELMTKRQESEEAIIDELKRIVKCV----EFLSDEYKFIDMYLKALRIRQINETSTSDGVESIMYS 397
            ..:  |..::||..:||::::..:    .|:..:..|...|.|.|..|.:...|.|...|..|.|
Human   569 SKL--RAGNKEATDEELEKMLDKIMIIFRFIYGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLS 631

  Fly   398 LLNKKMANFVTRCIYVQLRDVDKLRTLKKEFQDHLNSKGIK---------LGFDFRPKCFKNDGS 453
            .|..:.....|..:....:|::..:.:..:|:.::.::.:.         |...:.|       :
Human   632 KLKHECGAAFTSKLEGMFKDMELSKDIMIQFKQYMQNQNVPGNIELTVNILTMGYWP-------T 689

  Fly   454 FENFNLTLPDELQQAWKEFRIFY----EARKLQSKAII---QLNNELSSGEITCHLNQSVYILEV 511
            :....:.||.|:.:..:.|:.||    ..||||.::.:   .|..|...|:..         |:|
Human   690 YVPMEVHLPPEMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKE---------LQV 745

  Fly   512 STLQMAVLMLFNRHERFTEQELVTALGVELETLQEALKQI---KFLVYIEVNKVNYIE------I 567
            |..|..||::||..|.|:.:|:..|.|:|...|:..|:.:   |..|..:..|...||      .
Human   746 SLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFIC 810

  Fly   568 NMDFTNRKRRLFCNEPLPRKMRK-IEEKSEIELKIRRDK--QVDAAIVRIMKGQKQLEYSELISL 629
            |.||.::..|:..|:   .:|:: :||::....::.:|:  |:|||||||||.:|.|.::.|:|.
Human   811 NDDFKHKLFRIKINQ---IQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSE 872

  Fly   630 VYEELKDRVKPQVSFIKKRLDYLVEREYLERD----NYYN 665
            ||.:||..|||  :.:|||::.|::|:|:|||    |.||
Human   873 VYNQLKFPVKP--ADLKKRIESLIDRDYMERDKENPNQYN 910

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 169/756 (22%)
CULLIN 362..500 CDD:214545 30/154 (19%)
Cullin_Nedd8 606..661 CDD:287520 29/55 (53%)
CUL4BNP_003579.3 Nuclear localization signal. {ECO:0000269|PubMed:19801544} 55..58
Cullin 218..813 CDD:279260 126/644 (20%)
CULLIN 596..736 CDD:214545 29/147 (20%)
Cullin_Nedd8 842..907 CDD:214883 31/67 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.