DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and CUL3B

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001319357.1 Gene:CUL3B AraportID:AT1G69670 Length:732 Species:Arabidopsis thaliana

Alignment Length:768 Identity:153/769 (20%)
Similarity:301/769 (39%) Gaps:205/769 (27%)


  Fly    40 LMHLYHLIYKQCAA-------ERN-WNNPAQKNGRSLYIVLSDCLMKRLKNIAWVMENQL----- 91
            |.|..|.||...|:       .|| :|....|.|..||..|...:...||.|...:|...     
plant    32 LEHAIHEIYNHNASGLSFEELYRNAYNMVLHKYGDKLYTGLVTTMTFHLKEICKSIEEAQGGAFL 96

  Fly    92 --------DDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGDKETYPIYRLAM 148
                    |.||.:::|...|                      .:::|..:...|:|: ::.|.:
plant    97 ELLNRKWNDHNKALQMIRDIL----------------------MYMDRTYVSTTKKTH-VHELGL 138

  Fly   149 ISWKELVFEPSVTILAAIRLILSQMPREYNKSLEYQVYQVLQSIVELY---ANDKYQDVSLPSRI 210
            ..|::.|...|......:..:|..:.:|....:..:|  :::::::::   ....|||     ..
plant   139 HLWRDNVVYSSKIQTRLLNTLLDLVHKERTGEVIDRV--LMRNVIKMFMDLGESVYQD-----DF 196

  Fly   211 DKIFTEKVMDFYKSTTLHEFQKIVVSNDY---------KDFKHFLRYACLAMPEIENGTQFKAIL 266
            :|.|.|...:|||..:: ||.:.....:|         ::.:..:.|.     :.::..:..:::
plant   197 EKPFLEASAEFYKVESM-EFIESCDCGEYLKKAEKPLVEEVERVVNYL-----DAKSEAKITSVV 255

  Fly   267 KRYLAARLQETRLSGKDYIQAFLGLCRGPLQRALRDHTKLAEVVDAVCKEEINRKGQIIDPTRLL 331
            :|.:.|          :::|..:             |.:.:.:|:.:..::....|::..   |.
plant   256 EREMIA----------NHVQRLV-------------HMENSGLVNMLLNDKYEDMGRMYS---LF 294

  Fly   332 VTYANELMTKRQESEEAIIDELKRIVKCVEFLSDEYKFI-------DMYLKALRIRQINETSTSD 389
            ...||.|:|.|......:.:..|::|...|...|..:|:       |.|.:.:.:...|:.:..:
plant   295 RRVANGLVTVRDVMTLHLREMGKQLVTDPEKSKDPVEFVQRLLDERDKYDRIINMAFNNDKTFQN 359

  Fly   390 GVESIM--YSLLNKKMANFVTRCIYVQLR---------DV----DKLRTL----------KKEFQ 429
            .:.|..  :..||.:...|::..:..:||         ||    ||:..|          :|.::
plant   360 ALNSSFEYFVNLNTRSPEFISLFVDDKLRKGLKGVGEEDVDLILDKVMMLFRYLQEKDVFEKYYK 424

  Fly   430 DHLNSK---G------------IKL----GFDFRPKCFKNDGSFENFNLT--------------- 460
            .||..:   |            :||    |:.|..|.   :|.|.:...:               
plant   425 QHLAKRLLSGKTVSDDAERNLIVKLKTECGYQFTSKL---EGMFTDMKTSHDTLLGFYNSHPELS 486

  Fly   461 ------------------------LPDELQQAWKEFRIFYEARKLQSKAIIQLNNELSSGEITCH 501
                                    ||.|:....::||.:|.......:...|.|  :.:.:|...
plant   487 EGPTLVVQVLTTGSWPTQPTIQCNLPAEVSVLCEKFRSYYLGTHTGRRLSWQTN--MGTADIKAV 549

  Fly   502 LNQ-SVYILEVSTLQMAVLMLFNRHERFTEQELVTALGVELETLQEALKQI----------KFLV 555
            ..: ..:.|.|||.||.||||||..:|.:.:|:..|..:....|:..|:.:          |..:
plant   550 FGKGQKHELNVSTFQMCVLMLFNNSDRLSYKEIEQATEIPTPDLKRCLQSMACVKGKNVLRKEPM 614

  Fly   556 YIEVNKVNYIEINMDFTNRKRRLFCNEPLPRKMRKIEEKSEIELKIRRDK--QVDAAIVRIMKGQ 618
            ..|:.:.::..:|..|.::..::.....:.:|..: .||.|...::..|:  |::||||||||.:
plant   615 SKEIAEEDWFVVNDRFASKFYKVKIGTVVAQKETE-PEKQETRQRVEEDRKPQIEAAIVRIMKSR 678

  Fly   619 KQLEYSELISLVYEELKDRVKPQVSFIKKRLDYLVEREYLERDNY-YNIYRYL 670
            :.|:::.:|:.|.::|:.|.....:.||||::.|:||::|||||. ..:||||
plant   679 RVLDHNNIIAEVTKQLQTRFLANPTEIKKRIESLIERDFLERDNTDRKLYRYL 731

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 152/767 (20%)
CULLIN 362..500 CDD:214545 36/228 (16%)
Cullin_Nedd8 606..661 CDD:287520 24/55 (44%)
CUL3BNP_001319357.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.