DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul6 and AT1G59800

DIOPT Version :9

Sequence 1:NP_648620.1 Gene:Cul6 / 39474 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_176189.1 Gene:AT1G59800 / 842273 AraportID:AT1G59800 Length:255 Species:Arabidopsis thaliana


Alignment Length:224 Identity:44/224 - (19%)
Similarity:90/224 - (40%) Gaps:61/224 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   479 RKLQSKAIIQLNNEL------SSGEITCHLN-QSVY-----ILEVSTLQMAVLMLFNRHERFTEQ 531
            |.::.::....|.|:      ::..|..:.| |.:|     ::|...:|..:..|..:|:....:
plant    25 RMIEGESEPAFNQEIMMMMHTATYRICAYKNPQQLYDKYRELIENYAIQTVLPSLREKHDECMLR 89

  Fly   532 ELVTALGVELETLQEALKQIKFLVYIEVNKVNYIEINMDFTNRK-----RRLFCN---EPLPRKM 588
            ||.......           |.||.:...::.|::.:  |.::|     |.:..|   :.:.|:|
plant    90 ELAKRWNAH-----------KLLVRLFSRRLVYLDDS--FLSKKGLPSLREVGLNCFRDQVYREM 141

  Fly   589 RKIEEKSEIEL--KIRRDKQVDAAIVR------IMKGQKQLEYSELISLVYEELKDRVKPQ--VS 643
            :.:..::.:.|  |.|..:|:|..:||      :..|...|:       .|||..:|:..|  .|
plant   142 QSMAAEAILALIHKEREGEQIDRELVRNVIDVFVENGMGTLK-------KYEEDFERLMLQDTAS 199

  Fly   644 FIKKR----------LDY-LVEREYLERD 661
            :...:          ||| |..::.|:|:
plant   200 YYSSKASRWIQEESCLDYTLKPQQCLQRE 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 44/224 (20%)
CULLIN 362..500 CDD:214545 4/26 (15%)
Cullin_Nedd8 606..661 CDD:287520 17/73 (23%)
AT1G59800NP_176189.1 Cullin 41..>255 CDD:279260 41/208 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.