DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and AT1G59800

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_176189.1 Gene:AT1G59800 AraportID:AT1G59800 Length:255 Species:Arabidopsis thaliana

Alignment Length:224 Identity:44/225 (20%)
Similarity:90/225 (40%) Gaps:61/225 (27%)


  Fly   479 RKLQSKAIIQLNNEL------SSGEITCHLN-QSVY-----ILEVSTLQMAVLMLFNRHERFTEQ 531
            |.::.::....|.|:      ::..|..:.| |.:|     ::|...:|..:..|..:|:....:
plant    25 RMIEGESEPAFNQEIMMMMHTATYRICAYKNPQQLYDKYRELIENYAIQTVLPSLREKHDECMLR 89

  Fly   532 ELVTALGVELETLQEALKQIKFLVYIEVNKVNYIEINMDFTNRK-----RRLFCN---EPLPRKM 588
            ||.......           |.||.:...::.|::.:  |.::|     |.:..|   :.:.|:|
plant    90 ELAKRWNAH-----------KLLVRLFSRRLVYLDDS--FLSKKGLPSLREVGLNCFRDQVYREM 141

  Fly   589 RKIEEKSEIEL--KIRRDKQVDAAIVR------IMKGQKQLEYSELISLVYEELKDRVKPQ--VS 643
            :.:..::.:.|  |.|..:|:|..:||      :..|...|:       .|||..:|:..|  .|
plant   142 QSMAAEAILALIHKEREGEQIDRELVRNVIDVFVENGMGTLK-------KYEEDFERLMLQDTAS 199

  Fly   644 FIKKR----------LDY-LVEREYLERD 661
            :...:          ||| |..::.|:|:
plant   200 YYSSKASRWIQEESCLDYTLKPQQCLQRE 228

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 44/225 (20%)
CULLIN 362..500 CDD:214545 4/27 (15%)
Cullin_Nedd8 606..661 CDD:287520 18/74 (24%)
AT1G59800NP_176189.1 Cullin 41..>255 CDD:279260 41/209 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.