DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and AT1G59790

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_176188.1 Gene:AT1G59790 AraportID:AT1G59790 Length:374 Species:Arabidopsis thaliana

Alignment Length:285 Identity:59/286 (21%)
Similarity:102/286 (36%) Gaps:77/286 (27%)


  Fly   395 MYSLLNKKMANFVTRCIYVQLR---DVDKLRTLKKEFQDHLNSKGIKLGFDFRPKCFKNDGSFEN 456
            :|....|.:.::..:.:...||   |.|.||.|.|.:.:|                         
plant    66 LYEKYRKVIEDYTIQTVLPSLREKHDEDMLRELVKRWNNH------------------------- 105

  Fly   457 FNLTLPDELQQAWKEFRIFYEARKLQSKAIIQLNNELSSGEITCHLNQSVYILEVSTLQMAVLML 521
                   ::...|......|..|.|..::.|.:.: |....:||.|: .||....||.:..|:.|
plant   106 -------KIMVKWLSKFFVYIDRHLVRRSKIPIPS-LDEVGLTCFLD-LVYCEMQSTAKEVVIAL 161

  Fly   522 FNRHERFTEQELVTALGVELETLQEALKQIKFLVYIEVNKVNYIEINMDFT-----------NRK 575
            .:: ||            |.|.:..||.:....:|:|.......:...||.           :||
plant   162 IHK-ER------------EGEQIDRALVKNVLDIYVENGMGTLEKYEEDFESFMLQDTASYYSRK 213

  Fly   576 RRLFCNE-PLPRKMRKIEEKSEIELK--------IRRDKQVD----AAIVRIMKGQKQLEYSELI 627
            ...:..| ..|..|.|:||..::|.:        |...|.|:    ..:|.:.|.:.:.|:|...
plant   214 ASRWTEEDSCPDYMIKVEECLKMERERVTHYLHSITEPKLVEKIQNELLVMVTKNRLENEHSGFS 278

  Fly   628 SLVYEELKD---RVKPQVSFIKKRL 649
            :|:.::.|:   |:......|.|||
plant   279 ALLRDDKKNDLSRIYRLYLPIPKRL 303

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 59/286 (21%)
CULLIN 362..500 CDD:214545 18/108 (17%)
Cullin_Nedd8 606..661 CDD:287520 12/52 (23%)
AT1G59790NP_176188.1 Cullin 47..>357 CDD:279260 59/286 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.