DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and CUL2

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001318910.1 Gene:CUL2 AraportID:AT1G02980 Length:742 Species:Arabidopsis thaliana

Alignment Length:791 Identity:179/792 (23%)
Similarity:321/792 (41%) Gaps:213/792 (27%)


  Fly    22 LQVVNQIFDDYTSFDGQKLMHLYHLIYKQCAAER-----------------NWNN----PAQKNG 65
            ||.:.:...|...||..:.|.||..::..|..:.                 ::|.    ||.:..
plant    22 LQKILEEVPDEPPFDPVQRMQLYTTVHNLCTQKPPNDYSQQIYDRYGGVYVDYNKQTVLPAIREK 86

  Fly    66 RSLYIVLSDCLMKRLKNIAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVE 130
            ...|::..  |:||     |.  ||       :::.::|.|:..|             .:|.:..
plant    87 HGEYMLRE--LVKR-----WA--NQ-------KILVRWLSHFFEY-------------LDRFYTR 122

  Fly   131 RERLKGDKETYPIYRLAMISWKELVFEPSVTILAAIRLILSQMPRE---YNKSLEYQVYQVLQSI 192
            |    |...|  :..:..||:::||::...:......|.|....||   .:::|       |:::
plant   123 R----GSHPT--LSAVGFISFRDLVYQELQSKAKDAVLALIHKEREGEQIDRAL-------LKNV 174

  Fly   193 VELYAND------KY------------------------QDVSLPS---------RIDKIFTEKV 218
            :::|..:      ||                        |:.|.|.         |::|   |:|
plant   175 IDVYCGNGMGELVKYEEDFESFLLEDSASYYSRNASRWNQENSCPDYMIKAEESLRLEK---ERV 236

  Fly   219 MDFYKSTT------------LHEFQKIVVSNDYKDFKHFLR----------YACLAMPEIENGTQ 261
            .::..|||            |....|.::.|::...:..||          |. |..| |..|..
plant   237 TNYLHSTTEPKLVAKVQNELLVVVAKQLIENEHSGCRALLRDDKMDDLARMYR-LYHP-IPQGLD 299

  Fly   262 -----FK--------AILKRYL-AARLQETRLSG---------------KDYIQAFLGLCRGPLQ 297
                 ||        |::|:.. ||..:....||               .|....::..|   .|
plant   300 PVADLFKQHITVEGSALIKQATEAATDKAASTSGLKVQDQVLIRQLIDLHDKFMVYVDEC---FQ 361

  Fly   298 RALRDHTKLAEVVDAVCKEEINRKGQIIDPTRLLVTYANELM-----TKRQESEEAIIDELKRIV 357
            :....|..|.|..:..|    |:....:....:|.||.:.::     .::.|:|:..: .|:::|
plant   362 KHSLFHKALKEAFEVFC----NKTVAGVSSAEILATYCDNILKTGGGIEKLENEDLEL-TLEKVV 421

  Fly   358 KCVEFLSDEYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLR 422
            |.:.::||:..|.:.:.|....|.:.:.:.:|..|..:.:...:.:....|..:...|.|:    
plant   422 KLLVYISDKDLFAEFFRKKQARRLLFDRNGNDYHERSLLTKFKELLGAQFTSKMEGMLTDM---- 482

  Fly   423 TLKKEFQDHL-----NSKGIKLGFDFRPKCFKND--GSFENFNLTLPDELQQAWKEFRIFYEARK 480
            ||.||.|.:.     .:|..|||.||........  .|::..:|.||.|:....:.|:.:| ..|
plant   483 TLAKEHQTNFVEFLSVNKTKKLGMDFTVTVLTTGFWPSYKTTDLNLPIEMVNCVEAFKAYY-GTK 546

  Fly   481 LQSKAIIQLNNELSSGEITCHL----NQSVYILEVSTLQMAVLMLFNRHERFTEQELVTALGV-- 539
            ..|:   :|:...|.|  ||.|    ::....:.|:|.|.|||:|||..||.:..|::..|.:  
plant   547 TNSR---RLSWIYSLG--TCQLAGKFDKKTIEIVVTTYQAAVLLLFNNTERLSYTEILEQLNLGH 606

  Fly   540 -ELETLQEALKQIKFLVYIE------VNKVNYIEINMDFTNRKRRLFCNEPLPRKMRKIEEKSEI 597
             :|..|..:|..:|:.:.|:      ::..:..|.|..||::.||:  ..|||    .::|:.:|
plant   607 EDLARLLHSLSCLKYKILIKEPMSRNISNTDTFEFNSKFTDKMRRI--RVPLP----PMDERKKI 665

  Fly   598 ELKIRRDKQ--VDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIKKRLDYLVEREYLER 660
            ...:.:|::  :|||:|||||.:|.|.:.:|:|...|.|....||.:..||||::.|:.|:||||
plant   666 VEDVDKDRRYAIDAALVRIMKSRKVLGHQQLVSECVEHLSKMFKPDIKMIKKRIEDLISRDYLER 730

  Fly   661 D-NYYNIYRYL 670
            | :..|.::||
plant   731 DTDNPNTFKYL 741

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 176/787 (22%)
CULLIN 362..500 CDD:214545 34/145 (23%)
Cullin_Nedd8 606..661 CDD:287520 26/57 (46%)
CUL2NP_001318910.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.