DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and CUL3

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_174005.1 Gene:CUL3 AraportID:AT1G26830 Length:732 Species:Arabidopsis thaliana

Alignment Length:770 Identity:171/771 (22%)
Similarity:312/771 (40%) Gaps:180/771 (23%)


  Fly    24 VVNQIFDDYTSFDGQKLMHLYHLIYKQCAA-------ERN-WNNPAQKNGRSLYIVLSDCLMKRL 80
            ||:..:.|.|   .|.|....|.||.|.|:       .|| :|....|.|..||......:...|
plant    19 VVDPKYADKT---WQILERAIHQIYNQDASGLSFEELYRNAYNMVLHKFGEKLYTGFIATMTSHL 80

  Fly    81 KNIAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGDKETYPIYR 145
            |..:.::|.....:....|..|:.||    .::.|.:.....:.:|.::|     ..|:|: ::.
plant    81 KEKSKLIEAAQGGSFLEELNKKWNEH----NKALEMIRDILMYMDRTYIE-----STKKTH-VHP 135

  Fly   146 LAMISWKELVFEPSVTILAAIRLILSQMPRE-----YNKSLEYQVYQVLQSIVE-LYANDKYQDV 204
            :.:..|::.|...:......:..:|..:.:|     .::.|...|.::...:.| :|..|     
plant   136 MGLNLWRDNVVHFTKIHTRLLNTLLDLVQKERIGEVIDRGLMRNVIKMFMDLGESVYQED----- 195

  Fly   205 SLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVSNDYKDF--KHFLRYACLAMPEIENGTQFKAILK 267
                 .:|.|.:...:|||.    |.|:.:.|.|..|:  |...|..    .|||.       :.
plant   196 -----FEKPFLDASSEFYKV----ESQEFIESCDCGDYLKKSEKRLT----EEIER-------VA 240

  Fly   268 RYLAARLQE--TRLSGKDYIQAFLGLCRGPLQRALRDHTKLAEVVDAVCKEEINRKGQIID---- 326
            .||.|:.:|  |.:..|:.|       ...:||.:  |.:.:.:|:.:..::....|::.:    
plant   241 HYLDAKSEEKITSVVEKEMI-------ANHMQRLV--HMENSGLVNMLLNDKYEDLGRMYNLFRR 296

  Fly   327 PTRLLVTYANELMTK--RQESEEAIID--ELKRIVKCVEFLSDEYKFIDMYLKALRIRQINETST 387
            .|..||| ..::||.  |:..::.:.|  :.|..|:.|:.|.||.   |.|.|.:.....|:.:.
plant   297 VTNGLVT-VRDVMTSHLREMGKQLVTDPEKSKDPVEFVQRLLDER---DKYDKIINTAFGNDKTF 357

  Fly   388 SDGVESIM--YSLLNKKMANFVTRCIYVQLR---------DV----DKLRTL----------KKE 427
            .:.:.|..  :..||.:...|::..:..:||         ||    ||:..|          :|.
plant   358 QNALNSSFEYFINLNARSPEFISLFVDDKLRKGLKGITDVDVEVILDKVMMLFRYLQEKDVFEKY 422

  Fly   428 FQDHL---------------NSKGIKL----GFDFRPKCFKNDGSFENFNLT------------- 460
            ::.||               .|..:||    |:.|..|.   :|.|.:...:             
plant   423 YKQHLAKRLLSGKTVSDDAERSLIVKLKTECGYQFTSKL---EGMFTDMKTSEDTMRGFYGSHPE 484

  Fly   461 --------------------------LPDELQQAWKEFRIFYEARKLQSKAIIQLNNELSSGEIT 499
                                      ||.|:....::||.:|.......:...|.|  :.:.:|.
plant   485 LSEGPTLIVQVLTTGSWPTQPAVPCNLPAEVSVLCEKFRSYYLGTHTGRRLSWQTN--MGTADIK 547

  Fly   500 CHLNQ-SVYILEVSTLQMAVLMLFNRHERFTEQELVTALGVELETLQEALKQI----------KF 553
            ....: ..:.|.|||.||.||||||..:|.:.:|:..|..:....|:..|:.:          |.
plant   548 AIFGKGQKHELNVSTFQMCVLMLFNNSDRLSYKEIEQATEIPAADLKRCLQSLACVKGKNVIKKE 612

  Fly   554 LVYIEVNKVNYIEINMDFTNRKRRLFCNEPLPRKMRKIEEKSEIELKIRRDK--QVDAAIVRIMK 616
            .:..::.:.:...:|..||::..::.....:.:|..: .||.|...::..|:  |::||||||||
plant   613 PMSKDIGEEDLFVVNDKFTSKFYKVKIGTVVAQKETE-PEKQETRQRVEEDRKPQIEAAIVRIMK 676

  Fly   617 GQKQLEYSELISLVYEELKDRVKPQVSFIKKRLDYLVEREYLERDNY-YNIYRYL 670
            .:|.|:::.:|:.|.::|:.|.....:.||||::.|:||::||||:. ..:||||
plant   677 SRKILDHNNIIAEVTKQLQPRFLANPTEIKKRIESLIERDFLERDSTDRKLYRYL 731

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 169/768 (22%)
CULLIN 362..500 CDD:214545 38/221 (17%)
Cullin_Nedd8 606..661 CDD:287520 25/55 (45%)
CUL3NP_174005.1 Cullin 30..629 CDD:279260 130/652 (20%)
CULLIN 412..550 CDD:214545 20/143 (14%)
Cullin_Nedd8 659..726 CDD:214883 27/67 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.