| Sequence 1: | NP_648620.1 | Gene: | Cul6 / 39474 | FlyBaseID: | FBgn0036332 | Length: | 670 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_568658.1 | Gene: | CUL4 / 834663 | AraportID: | AT5G46210 | Length: | 792 | Species: | Arabidopsis thaliana |
| Alignment Length: | 766 | Identity: | 172/766 - (22%) |
|---|---|---|---|
| Similarity: | 311/766 - (40%) | Gaps: | 184/766 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 5 KRISNYFDSMLPLIDNILQVVNQIFDDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQK---NGR 66
Fly 67 SLYIVLSDCLMKRLKNIAWVMENQLDDNKPIRLIAKYLEH-WV---PYQRSCEKLNLACYHFNRN 127
Fly 128 W---VERERLKGDKETYPIYRLAMISWKELVFEPSVTILAAIRLILSQMPREYNKSLEYQVYQVL 189
Fly 190 QSIVELYANDKYQDVSLPSRIDKIFTEKVMDFY--------KSTTLHEFQKIVVSNDYKDFKHFL 246
Fly 247 RY--ACLAMPEIENGTQFKAILKRYLAARLQE---TRLSGK-------------------DYIQA 287
Fly 288 FLGLCRGPLQRALRDHTKLAEVV----------DAVCKEEINRK---GQIID------------- 326
Fly 327 PTRLLVTYANELMT--KRQESEEAIIDELKRIVKCVEFLSDEYKFIDMYLKALRIRQINETSTSD 389
Fly 390 GVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRTLKKEFQDHLNSK-----GIKLGF-----DFR 444
Fly 445 PKCFKNDGSFENFNLTLPDEL---QQAWKEFRIF-YEARKLQSKAIIQLNNELSSGEITCHLNQS 505
Fly 506 VYILEVSTLQMAVLMLFNRHERFTEQELVTALGVELETLQEALKQIKFLVYIEVNKVNYIEIN-- 568
Fly 569 -MDFTNRKRRLFCNE---PLPR------KMRK-IEEKSEIELKIRRDK--QVDAAIVRIMKGQKQ 620
Fly 621 LEYSELISLVYEELKDRVKPQVSFIKKRLDYLVEREYLERD-NYYNIYRYL 670 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Cul6 | NP_648620.1 | COG5647 | 25..670 | CDD:227934 | 164/744 (22%) |
| CULLIN | 362..500 | CDD:214545 | 31/151 (21%) | ||
| Cullin_Nedd8 | 606..661 | CDD:287520 | 27/54 (50%) | ||
| CUL4 | NP_568658.1 | Cullin | 96..693 | CDD:395716 | 132/664 (20%) |
| Cullin_Nedd8 | 724..780 | CDD:402267 | 27/57 (47%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5647 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1040292at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR11932 |
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.920 | |||||