DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and CUL4

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_568658.1 Gene:CUL4 AraportID:AT5G46210 Length:792 Species:Arabidopsis thaliana

Alignment Length:766 Identity:172/767 (22%)
Similarity:311/767 (41%) Gaps:184/767 (24%)


  Fly     5 KRISNYFDSMLPLIDNILQVVNQIFDDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQK---NGR 66
            |:||...:|:...:||:.         ....||:    ||..|.|:|  |.:.:...|.   ...
plant   110 KKISFDLESLYQAVDNLC---------LHKLDGK----LYDQIEKEC--EEHISAALQSLVGQNT 159

  Fly    67 SLYIVLSDCLMKRLKNIAWVMENQLDDNKPIRLIAKYLEH-WV---PYQRSCEKLNLACYHFNRN 127
            .|.:.||     |::. .|  ::..|....||.||..|:. :|   |..||..::.|..:..:.:
plant   160 DLTVFLS-----RVEK-CW--QDFCDQMLMIRSIALTLDRKYVIQNPNVRSLWEMGLQLFRKHLS 216

  Fly   128 W---VERERLKGDKETYPIYRLAMISWKELVFEPSVTILAAIRLILSQMPREYNKSLEYQVYQVL 189
            .   ||:..:||        .|:||. ||.:.|      |..|.:||.:         .:::..|
plant   217 LAPEVEQRTVKG--------LLSMIE-KERLAE------AVNRTLLSHL---------LKMFTAL 257

  Fly   190 QSIVELYANDKYQDVSLPSRIDKIFTEKVMDFY--------KSTTLHEFQKIVVSNDYKDFKHFL 246
            ...:|.:              :|.|.|...:||        :.:.:.|:.|.|....:::.:..:
plant   258 GIYMESF--------------EKPFLEGTSEFYAAEGMKYMQQSDVPEYLKHVEGRLHEENERCI 308

  Fly   247 RY--ACLAMPEIENGTQFKAILKRYLAARLQE---TRLSGK-------------------DYIQA 287
            .|  |....|.|.  |..:.:|:|::...|::   |.:.|:                   ...||
plant   309 LYIDAVTRKPLIT--TVERQLLERHILVVLEKGFTTLMDGRRTEDLQRMQTLFSRVNALESLRQA 371

  Fly   288 FLGLCRGPLQRALRDHTKLAEVV----------DAVCKEEINRK---GQIID------------- 326
            .....|...|:.:.|..|..::|          |.:.:|...:.   |..|.             
plant   372 LSSYVRKTGQKIVMDEEKDKDMVQSLLDFKASLDIIWEESFYKNESFGNTIKDSFEHLINLRQNR 436

  Fly   327 PTRLLVTYANELMT--KRQESEEAIIDELKRIVKCVEFLSDEYKFIDMYLKALRIRQINETSTSD 389
            |..|:..:.:|.:.  .:..|||.:...|::::....|:..:..|...|.|.|..|.:...|.|.
plant   437 PAELIAKFLDEKLRAGNKGTSEEELESVLEKVLVLFRFIQGKDVFEAFYKKDLAKRLLLGKSASI 501

  Fly   390 GVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRTLKKEFQDHLNSK-----GIKLGF-----DFR 444
            ..|..|.|.|..:..:..|..:....:|::..:.:.:.|:....::     ||::..     .:.
plant   502 DAEKSMISKLKTECGSQFTNKLEGMFKDIELSKEINESFKQSSQARTKLPSGIEMSVHVLTTGYW 566

  Fly   445 PKCFKNDGSFENFNLTLPDEL---QQAWKEFRIF-YEARKLQSKAIIQLNNELSSGEITCHLNQS 505
            |       ::...::.||.||   |..:|||.:. |..|:|      ...|.|....:....::.
plant   567 P-------TYPPMDVKLPHELNVYQDIFKEFYLSKYSGRRL------MWQNSLGHCVLKADFSKG 618

  Fly   506 VYILEVSTLQMAVLMLFNRHERFTEQELVTALGVELETLQEALKQIKFLVYIEVNKVNYIEIN-- 568
            ...|.||..|..||||||...:.:.:::..:..:|.:.|:..|:.      :...||..::.|  
plant   619 KKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTSIEDKELRRTLQS------LACGKVRVLQKNPK 677

  Fly   569 -MDFTNRKRRLFCNE---PLPR------KMRK-IEEKSEIELKIRRDK--QVDAAIVRIMKGQKQ 620
             .|..:.....|.:|   ||.|      :|:: :||.:....::.:|:  |:|||||||||.:|.
plant   678 GRDVEDGDEFEFNDEFAAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKV 742

  Fly   621 LEYSELISLVYEELKDRVKPQVSFIKKRLDYLVEREYLERD-NYYNIYRYL 670
            |.::.||:.::::||..:||  :.:|||::.|::||||||: :...||.||
plant   743 LSHTLLITELFQQLKFPIKP--ADLKKRIESLIDREYLEREKSNPQIYNYL 791

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 165/745 (22%)
CULLIN 362..500 CDD:214545 31/152 (20%)
Cullin_Nedd8 606..661 CDD:287520 28/55 (51%)
CUL4NP_568658.1 Cullin 97..692 CDD:279260 132/664 (20%)
CULLIN 474..615 CDD:214545 31/154 (20%)
Cullin_Nedd8 721..785 CDD:214883 29/66 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.