DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and AT4G12100

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_192947.1 Gene:AT4G12100 AraportID:AT4G12100 Length:434 Species:Arabidopsis thaliana

Alignment Length:485 Identity:89/486 (18%)
Similarity:165/486 (34%) Gaps:157/486 (32%)


  Fly     7 ISNYFDSMLPLIDNILQVVNQIFDDYTSFDGQKLMH--LYHLIYKQCAAERNWNNPAQKNGRSLY 69
            ::..:|.:.|.|..||.      ||.....|..|..  ::..:.:.|..:     |.|.. ....
plant    77 LAKAWDLLKPAIKIILD------DDEYKKPGDVLCFTTIFRAVKRACLGD-----PRQSE-LVFN 129

  Fly    70 IVLSDCLMKRLKNIAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKL-NLACYHFNRNWVERER 133
            :|..:|.....:.|..:.:|....:.|...:......|:.::|....: ::|.|         :.
plant   130 LVKHECEPHIAELIQSLEKNCSGSDDPSVFLPHVYNRWLDFKRKMSLVSDVAMY---------QT 185

  Fly   134 LKGDKETYPIYRLAMISW--------KELVFEPSV---TILAAIRLILSQ-MPREYNKSLEYQVY 186
            |.|           :..|        |:|...|.:   .|...:|||..: :.:..|.:.:    
plant   186 LNG-----------LTLWDVGQKLFHKQLSMAPQLQDQVITGILRLITDERLGKAANNTSD---- 235

  Fly   187 QVLQSIVELY-----ANDKYQDVSLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVSNDYKDFKHFL 246
             :|:::::::     ....|:|..|.|      |.|   ||........|:       .|..|:|
plant   236 -LLKNLMDMFRMQWQCTYVYKDPFLDS------TSK---FYAEEAEQVLQR-------SDISHYL 283

  Fly   247 RYACLAMPEIENGTQFKAILKRYLAARLQETRLSGKDYIQAFLGLCRGPLQRALRDHTKLAEVVD 311
            :|                :.:.:||    |.....|.|.  |....|..|.:.|:  ::|.|...
plant   284 KY----------------VERTFLA----EEEKCDKHYF--FFSSSRSRLMKVLK--SQLLEAHS 324

  Fly   312 AVCKEEINRKGQIIDPTRLLVTYANELMTKRQESEEAIIDELKRIVKCVEFLSDEYKFIDMYLKA 376
            :..:|..          .||:             :|::||:|:|:.:....:..| .:||..|:|
plant   325 SFLEEGF----------MLLM-------------DESLIDDLRRMYRLFSMVDSE-DYIDRILRA 365

  Fly   377 LRIRQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRTLKKEFQDHLNSKGIKLGF 441
            ..:.: .|.:..:|....:::.::|         |:.|....|.|  |.|..:|           
plant   366 YILAK-GEGARQEGSLQELHTSIDK---------IWHQCFGQDDL--LDKTIRD----------- 407

  Fly   442 DFRPKCFKNDGSFENFNLTLPDEL--QQAW 469
                 |      ||.|.|.:|.|.  |..|
plant   408 -----C------FEGFGLHVPGEFSDQLQW 426

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 84/468 (18%)
CULLIN 362..500 CDD:214545 24/111 (22%)
Cullin_Nedd8 606..661 CDD:287520
AT4G12100NP_192947.1 Cullin 82..>412 CDD:279260 83/465 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.