DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and CUL1

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001031575.1 Gene:CUL1 AraportID:AT4G02570 Length:738 Species:Arabidopsis thaliana

Alignment Length:775 Identity:184/776 (24%)
Similarity:321/776 (41%) Gaps:163/776 (21%)


  Fly     9 NYFDSMLPLIDNILQVVNQIFDDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLYIVLS 73
            :|..:.:..:..||:.:|:     .:||.::.|.||..||..|.     ..|.....:.||....
plant    13 DYMQTGITKLKRILEGLNE-----PAFDSEQYMMLYTTIYNMCT-----QKPPHDYSQQLYDKYR 67

  Fly    74 DCLMKRLKNIAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGDK 138
            :...:.:.:.......:..|...:|.:.|   .|..::.....|:...|:.:|.::.|..|.   
plant    68 EAFEEYINSTVLPALREKHDEFMLRELFK---RWSNHKVMVRWLSRFFYYLDRYFIARRSLP--- 126

  Fly   139 ETYPIYRLAMISWKELVFEP--SVTILAAIRLI-------------------------LSQMPRE 176
               |:..:.:..:::||:..  |....|.|.|:                         :.||.| 
plant   127 ---PLNEVGLTCFRDLVYNELHSKVKQAVIALVDKEREGEQIDRALLKNVLDIYVEIGMGQMER- 187

  Fly   177 YNKSLEYQVYQVLQSIVELYANDKYQDVSLPSRIDKI------FTEKVMDFYKSTT--------L 227
            |.:..|..:.|...|.....|:...|:.|.|..:.|.      ..|:|..:..|::        .
plant   188 YEEDFESFMLQDTSSYYSRKASSWIQEDSCPDYMLKSEECLKKERERVAHYLHSSSEPKLVEKVQ 252

  Fly   228 HEFQKIVVSNDYKDFKHFLRYACLAM----------------PEIENGTQFKA-ILKRYLAAR-- 273
            ||. .:|.::...:.:|   ..|.|:                .:|..|.:..| |.|:::.|.  
plant   253 HEL-LVVFASQLLEKEH---SGCRALLRDDKVDDLSRMYRLYHKILRGLEPVANIFKQHVTAEGN 313

  Fly   274 -------------------LQETRLSGK-----DYIQAFLGLCRGPLQRALRDHTKLAEVVDAVC 314
                               :||..|..|     |....::..|   .|.....|..|.|..:..|
plant   314 ALVQQAEDTATNQVANTASVQEQVLIRKVIELHDKYMVYVTEC---FQNHTLFHKALKEAFEIFC 375

  Fly   315 KEEINRKGQIIDPTRLLVTYANELMTK---RQESEEAIIDELKRIVKCVEFLSDEYKFIDMYLKA 376
            .:.:.....    ..||.|:.:.::.|   .:.|:|||.|.|:::||.:.::||:..|.:.|.|.
plant   376 NKTVAGSSS----AELLATFCDNILKKGGSEKLSDEAIEDTLEKVVKLLAYISDKDLFAEFYRKK 436

  Fly   377 LRIRQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRTLKKEFQDHLNSK-----G 436
            |..|.:.:.|.:|..|..:.:.|.::.....|..:...:.|:...|..:..|:|:|.|.     |
plant   437 LARRLLFDRSANDDHERSILTKLKQQCGGQFTSKMEGMVTDLTLARENQNSFEDYLGSNPAANPG 501

  Fly   437 IKLGF-----DFRPKCFKNDGSFENFNLTLPDELQQAWKEFRIFYEARKLQSKAIIQLNNELSSG 496
            |.|..     .|.|       |:::|::.||.|:.:..:.|:.|||.:....|    |....|.|
plant   502 IDLTVTVLTTGFWP-------SYKSFDINLPSEMIKCVEVFKGFYETKTKHRK----LTWIYSLG 555

  Fly   497 EITCHLN----QSVYILEVSTLQMAVLMLFNRHERFTEQELVTALGVELETLQEALKQI---KFL 554
              |||:|    |....|.|||.|.|||:|||..::.:..|::..|.:..|.|...|..:   |:.
plant   556 --TCHINGKFDQKAIELIVSTYQAAVLLLFNTTDKLSYTEILAQLNLSHEDLVRLLHSLSCAKYK 618

  Fly   555 VYIE------VNKVNYIEINMDFTNRKRRLFCNEPLPRKMRKIEEKSEIELKIRRDKQ--VDAAI 611
            :.::      |::.:..|.|..||:|.||:  ..|||    .::|:.::...:.:|::  :||||
plant   619 ILLKEPNTKTVSQNDAFEFNSKFTDRMRRI--KIPLP----PVDERKKVVEDVDKDRRYAIDAAI 677

  Fly   612 VRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIKKRLDYLVEREYLERDNYY-NIYRYL 670
            |||||.:|.|.:.:|:|...|:|....||.:..||||::.|:.|:|||||... |::|||
plant   678 VRIMKSRKVLGHQQLVSECVEQLSRMFKPDIKAIKKRMEDLITRDYLERDKENPNMFRYL 737

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 180/758 (24%)
CULLIN 362..500 CDD:214545 37/148 (25%)
Cullin_Nedd8 606..661 CDD:287520 27/57 (47%)
CUL1NP_001031575.1 Cullin 34..640 CDD:279260 138/645 (21%)
CULLIN 422..563 CDD:214545 40/154 (26%)
Cullin_Nedd8 670..730 CDD:287520 28/60 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.