DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul6 and AT3G46910

DIOPT Version :9

Sequence 1:NP_648620.1 Gene:Cul6 / 39474 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_190275.1 Gene:AT3G46910 / 823844 AraportID:AT3G46910 Length:247 Species:Arabidopsis thaliana


Alignment Length:240 Identity:49/240 - (20%)
Similarity:89/240 - (37%) Gaps:50/240 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 LYANDKYQDVSLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVSNDYKDFKHFLRYACLAMPEIENG 259
            :|..|.:  ..|...|..||.::..||..|...:...|                   :..|..:|
plant    24 IYVEDAW--TMLKPAIRAIFLDEPQDFACSGLFNAVNK-------------------SWCEKSSG 67

  Fly   260 -TQFKAILKR---YLAARLQETRLSGKDYIQAFLGLCRGPLQRALRDHTKLAEVVDAVCKEEINR 320
             ..:|.||:.   |::|.:|............||.|    |::...|..:..:.:.::...|   
plant    68 EALYKLILEECEIYISAAIQSLESQCDTDPSLFLSL----LEKCWLDFRRKLQFLCSIAGGE--- 125

  Fly   321 KGQIIDPTRLLVTYANELMTKRQESEEAIIDELKRIVKCVEFLSDEYKFIDMYLKALRIRQINET 385
             ||.:.| ..:....:||..|...|.:.:.|:|..|:  ::.:.|:..|:.:.:..|:       
plant   126 -GQTVGP-HSVWDLGSELSPKHLFSAQKVRDKLLSII--LQLIRDQRSFMSVDMTQLK------- 179

  Fly   386 STSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRTLKKEFQD 430
            :|:..|.|:..:.||.....|..:.:|       |....||.|.|
plant   180 NTTRPVMSVHMTQLNNLRGLFYGQSLY-------KSPFFKKPFID 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 49/240 (20%)
CULLIN 362..500 CDD:214545 15/69 (22%)
Cullin_Nedd8 606..661 CDD:287520
AT3G46910NP_190275.1 Cullin 33..>244 CDD:279260 47/229 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.