DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and cul5

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001072836.1 Gene:cul5 XenbaseID:XB-GENE-484069 Length:780 Species:Xenopus tropicalis

Alignment Length:811 Identity:176/812 (22%)
Similarity:325/812 (40%) Gaps:201/812 (25%)


  Fly    11 FDSMLPLIDNILQVVNQIFDDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSDC 75
            :|.|.|:   :|:::.|     .|...|:...|:..::..|.    |::   |....::..|.:.
 Frog    19 WDFMRPI---VLKLLRQ-----ESVTKQQWFDLFSDVHAVCL----WDD---KGPAKIHQALKED 68

  Fly    76 LMKRLKNI-AWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERE--RLKGD 137
            ::..:|.. |.|:.:| ||.   .|:..|:..|..:...|:.|...........:.::  ..|.:
 Frog    69 ILDFIKQAQARVLSHQ-DDT---ALLKAYIVEWRKFFTQCDILPKPFCQLEITLMGKQGSNKKSN 129

  Fly   138 KETYPIYRLAMISWKELVFEPSVTIL--AAIRLI-LSQMPREYNKSLEYQVYQVLQSIVELYAN- 198
            .|...:.:|.:.:|.|.:|......|  :|::|: ..::...::..|   |..|.:|.|.|.:| 
 Frog   130 VEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQL---VIGVRESYVNLCSNP 191

  Fly   199 -DK---YQDVSLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVSNDYKDFKHFLRYACLAMPEIENG 259
             ||   |:|     ..:|.:.:....||::......|:..|.|       :::||...:.|.|| 
 Frog   192 EDKLQIYRD-----NFEKAYLDSTERFYRTQAPSYLQQNGVQN-------YMKYADAKLKEEEN- 243

  Fly   260 TQFKAILKRYLAAR--------LQETRLSG--KDYIQAFLGLCRG-------------------- 294
               :|:  |||..|        |.|..::.  ..:.:..|..|:|                    
 Frog   244 ---RAL--RYLETRRECNSVQALMECCVNALVTSFKETILAECQGMIKRNETEKLHLMFSLMDKV 303

  Fly   295 -----PLQRALRDHTKLAEVVDAVCKEE----------------INRKGQII------DP----- 327
                 |:.:.|.:|...|.:.|.|...|                .||..:::      ||     
 Frog   304 PNGIEPMLKDLEEHIVSAGLADMVAAAETITTDSEKYVEQLLTLFNRFSKLVKEAFQDDPRFLTA 368

  Fly   328 ------------------------------------TRLLVTYANELMTK----RQESEEAIIDE 352
                                                ..||..|.:.|:.|    ::.:.|.|..:
 Frog   369 RDKAYKAVVNDATIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRKTPLSKKLTSEEIEAK 433

  Fly   353 LKRIVKCVEFLSDEYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNK--KMANFVTRCIYVQL 415
            ||.::..::::.::..|:..:...|..|.|.:.|....:|..|...|.:  ..|::|.: :....
 Frog   434 LKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWLREVGMPADYVNK-LARMF 497

  Fly   416 RDVDKLRTLKKEFQD-HLNSKGIKLGFDFRPKCFKNDG----SFENFNLTLPDELQQAWKEFRIF 475
            :|:.....|.:.|:: |.|:| :.|..|.......|.|    |.|...::||.||:....|...|
 Frog   498 QDIKVSEDLNQAFKEMHKNNK-LALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEF 561

  Fly   476 YEARKLQSKAIIQLNNELSSGEITCHLNQSVYILEVSTLQMAVLMLFNRHER----FTEQELVTA 536
            |  :|..|...:..::.:|:|.||.......|.|||:|.|:|||..:|:..|    |...:|.|.
 Frog   562 Y--KKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATE 624

  Fly   537 L-GVEL-ETLQE--ALKQIKFLVYIEVNKVNYIEINMDFT-------NRKRRLFCNEPLPR---- 586
            | ..|| .||..  |..::|..|......||..:   |||       |::..|..|..:.:    
 Frog   625 LPDAELRRTLWSLVAFPKLKRQVLSYEPTVNSPK---DFTEGTLFSVNQEFSLIKNGKVQKRGKI 686

  Fly   587 -----------KMRKIEEKSEIELKIRRDKQVDAAIVRIMKGQKQLEYSELISLVYEELKDRVKP 640
                       :||:.|.:..::|:|.|.::   ||::|||.:|::..::|.:.:.|.||:...|
 Frog   687 NLIGRLQLTTERMREEENEGIVQLRILRTQE---AIIQIMKMRKKITNAQLQTELVEILKNMFLP 748

  Fly   641 QVSFIKKRLDYLVEREYLERD-NYYNIYRYL 670
            |...||:::::|:|.:|::|| :..|.:.|:
 Frog   749 QKKMIKEQIEWLIEHKYIKRDESDINTFIYM 779

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 172/796 (22%)
CULLIN 362..500 CDD:214545 35/145 (24%)
Cullin_Nedd8 606..661 CDD:287520 18/55 (33%)
cul5NP_001072836.1 Cullin 20..671 CDD:279260 147/698 (21%)
CULLIN 443..586 CDD:214545 35/147 (24%)
Cullin_Nedd8 713..772 CDD:287520 20/62 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.