DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and Cul5

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_082083.3 Gene:Cul5 MGIID:1922967 Length:780 Species:Mus musculus

Alignment Length:808 Identity:176/809 (22%)
Similarity:324/809 (40%) Gaps:195/809 (24%)


  Fly    11 FDSMLPLIDNILQVVNQIFDDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSDC 75
            :|.|.|:   :|:::.|     .|...|:...|:..::..|.    |::   |....::..|.:.
Mouse    19 WDFMHPI---VLKLLRQ-----ESVTKQQWFDLFSDVHAVCL----WDD---KGSSKIHQALKED 68

  Fly    76 LMKRLKNI-AWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERE--RLKGD 137
            :::.:|.. |.|:.:| ||.   .|:..|:..|..:...|:.|...........:.::  ..|.:
Mouse    69 ILEFIKQAQARVLSHQ-DDT---ALLKAYIVEWRKFFTQCDILPKPFCQLEVTLLGKQSSNKKSN 129

  Fly   138 KETYPIYRLAMISWKELVFEPSVTIL--AAIRLI-LSQMPREYNKSLEYQVYQVLQSIVELYAN- 198
            .|...:.:|.:.:|.|.:|......|  :|::|: ..::...::..|   |..|.:|.|.|.:| 
Mouse   130 MEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQL---VIGVRESYVNLCSNP 191

  Fly   199 -DK---YQDVSLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVSNDYKDFKHFLRYACLAMPEIENG 259
             ||   |:|     ..:|.:.:....||::......|:..|.|       :::||...:.|.|. 
Mouse   192 EDKLQIYRD-----NFEKAYLDSTERFYRTQAPSYLQQNGVQN-------YMKYADAKLKEEEK- 243

  Fly   260 TQFKAILKRYLAAR--------LQETRLSG--KDYIQAFLGLCRG-------------------- 294
               :|:  |||..|        |.|..::.  ..:.:..|..|:|                    
Mouse   244 ---RAL--RYLETRRECNSVEALMECCVNALVTSFKETILAECQGMIKRNETEKLHLMFSLMDKV 303

  Fly   295 -----PLQRALRDHTKLAEVVDAVCKEE----------------INRKGQII------DP----- 327
                 |:.:.|.:|...|.:.|.|...|                .||..:::      ||     
Mouse   304 PNGIEPMLKDLEEHIISAGLADMVAAAETITTDSEKYVEQLLTLFNRFSKLVKEAFQDDPRFLTA 368

  Fly   328 ------------------------------------TRLLVTYANELMTK----RQESEEAIIDE 352
                                                ..||..|.:.|:.|    ::.:.|.|..:
Mouse   369 RDKAYKAVVNDATIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRKTPLSKKLTSEEIEAK 433

  Fly   353 LKRIVKCVEFLSDEYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNK--KMANFVTRCIYVQL 415
            ||.::..::::.::..|:..:...|..|.|.:.|....:|..|...|.:  ..|::|.: :....
Mouse   434 LKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWLREVGMPADYVNK-LARMF 497

  Fly   416 RDVDKLRTLKKEFQD-HLNSKGIKLGFDFRPKCFKNDG----SFENFNLTLPDELQQAWKEFRIF 475
            :|:.....|.:.|:: |.|:| :.|..|.......|.|    |.|...::||.||:....|...|
Mouse   498 QDIKVSEDLNQAFKEMHKNNK-LALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEF 561

  Fly   476 YEARKLQSKAIIQLNNELSSGEITCHLNQSVYILEVSTLQMAVLMLFNRHER----FTEQELVTA 536
            |  :|..|...:..::.:|:|.||.......|.|||:|.|:|||..:|:..|    |...:|.|.
Mouse   562 Y--KKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATE 624

  Fly   537 L-GVEL-ETLQE--ALKQIKFLVYIEVNKVN---------YIEINMDFT---NRK--RRLFCN-- 581
            | ..|| .||..  |..::|..|.:...:||         ...:|.||:   |.|  :|...|  
Mouse   625 LPDAELRRTLWSLVAFPKLKRQVLLYDPQVNSPKDFTEGTLFSVNQDFSLIKNAKVQKRGKINLI 689

  Fly   582 ---EPLPRKMRKIEEKSEIELKIRRDKQVDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVS 643
               :....:||:.|.:..::|:|.|.::   ||::|||.:|::..::|.:.:.|.||:...||..
Mouse   690 GRLQLTTERMREEENEGIVQLRILRTQE---AIIQIMKMRKKISNAQLQTELVEILKNMFLPQKK 751

  Fly   644 FIKKRLDYLVEREYLERDNY-YNIYRYL 670
            .||:::::|:|..|:.||.. .|.:.|:
Mouse   752 MIKEQMEWLIEHRYIRRDEADINTFIYM 779

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 172/793 (22%)
CULLIN 362..500 CDD:214545 35/145 (24%)
Cullin_Nedd8 606..661 CDD:287520 18/55 (33%)
Cul5NP_082083.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.