DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and cul1

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001039255.1 Gene:cul1 XenbaseID:XB-GENE-945766 Length:776 Species:Xenopus tropicalis

Alignment Length:786 Identity:202/787 (26%)
Similarity:343/787 (44%) Gaps:167/787 (21%)


  Fly    25 VNQIFDD--------YT--SFDGQKLMHLYHLIYKQCAAERNWNN------PAQKN--------- 64
            ::||:||        ||  |....:.|.||..:|..|.:....|.      |..|:         
 Frog    17 LDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPGGA 81

  Fly    65 ---GRSLYIVLSDCLMKRLKNIAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNR 126
               |..||..|.:.|...|.|:....|:.:|::    ::..|.:.|..|:.|.:.||..|.:.||
 Frog    82 QFVGLELYKRLKEFLKNYLTNLLKDGEDLMDES----VLKFYTQQWEDYRFSSKVLNGICAYLNR 142

  Fly   127 NWVERERLKGDKETYPIYRLAMISWKELVFEP---SVT--ILAAI-----------RLI------ 169
            :||.||..:|.|..|.||.||:::|::.:|:|   .||  :|..|           |||      
 Frog   143 HWVRRECDEGRKGIYEIYSLALVTWRDCLFKPLNKQVTNAVLKLIEKERNGETINTRLISGVVQS 207

  Fly   170 --------------------------------------------LSQMP-REYNKSLEYQVYQVL 189
                                                        |.|.| .||.|..|.::.:. 
 Frog   208 YVELGLNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEE- 271

  Fly   190 QSIVELYANDKYQDVSLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVSNDYKDFKHFLRYACLAMP 254
            |..|::|.::..|| .|..:.:::..||.::.:.:    |||.::.::..:|......    .:.
 Frog   272 QRRVQVYLHESTQD-ELARKCEQVLIEKHLEIFHT----EFQNLLDADKNEDLGRMYN----LVS 327

  Fly   255 EIENGTQFKAILKRYLAARLQETRLSG------------KDYIQAFLGLCR---GPLQRALRDHT 304
            .|::|.   ..||:.|...:....|:.            |.|:|..|.:.:   ..:..|..:..
 Frog   328 RIQDGL---GELKKLLETHIHNQGLAAIEKCGEAAQNDPKMYVQTVLDVHKKYNALVMSAFNNDA 389

  Fly   305 KLAEVVDAVCKEEINRKG------QIIDPTRLLVTYANELMTKRQES-EEA-IIDELKRIVKCVE 361
            .....:|..|...||...      .......||..|.:.|:.|..:: ||| :.|.|.:::...:
 Frog   390 GFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFK 454

  Fly   362 FLSDEYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRTLKK 426
            ::.|:..|...|.|.|..|.:::.|.||..|:.|.|.|.:......|..:....:|:...:.|.:
 Frog   455 YIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNE 519

  Fly   427 EFQDHL-NSKGIKLGFDFRPKCFKNDGS--FENF-NLTLPDELQQAWKEFRIFYEARKLQSKAII 487
            :|:.|| ||:.:.|.|..:   ..:.||  |:.| ...||.||:::::.|..||.:|....|  :
 Frog   520 QFKKHLTNSEPLDLDFSIQ---VLSSGSWPFQQFCTFALPSELERSYQRFTAFYASRHSGRK--L 579

  Fly   488 QLNNELSSGEITCHLNQSVYILEVSTLQMAVLMLFNRHERFTEQELVTALGVELETLQEALK--- 549
            ....:||.||:..:..::.|.|:.||.|||:|:.:|..:.:|.|:|..:..::::.|.:.|:   
 Frog   580 TWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILVQVLQILL 644

  Fly   550 QIKFLVYIEVN-KVNYIEINMD--------FTNRKRRLFCNEPLPRKMRKIEEKSEIEL---KIR 602
            :.|.||..:.| .|:.:::..|        :.|:|.|:..|.|:     |.|:|.|.|.   .|.
 Frog   645 KSKLLVLEDENANVDDVDLKPDILIKLYLGYKNKKLRVNINVPM-----KTEQKQEQETTHKNIE 704

  Fly   603 RDKQ--VDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIKKRLDYLVEREYLER-DNYY 664
            .|::  :.||||||||.:|.|::.:|:..|..:|..|.||:|..|||.:|.|:|:||||| |...
 Frog   705 EDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEK 769

  Fly   665 NIYRYL 670
            :.|.||
 Frog   770 DTYSYL 775

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 201/785 (26%)
CULLIN 362..500 CDD:214545 40/142 (28%)
Cullin_Nedd8 606..661 CDD:287520 28/58 (48%)
cul1NP_001039255.1 Cullin 22..662 CDD:279260 155/662 (23%)
CULLIN 455..590 CDD:214545 40/140 (29%)
Cullin_Nedd8 703..770 CDD:214883 31/67 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.870

Return to query results.
Submit another query.