DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and Cul4b

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001103612.1 Gene:Cul4b MGIID:1919834 Length:970 Species:Mus musculus

Alignment Length:756 Identity:169/757 (22%)
Similarity:301/757 (40%) Gaps:175/757 (23%)


  Fly    30 DDYTSFDGQKLMHLYHLIYKQCAAERNW--------NNPAQKNGRSLYIVLSDCLMKRLK-NIAW 85
            ::||....|||......|....:.:.|.        |..:.|...:||..|.......:| .|..
Mouse   267 ENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISANLYKQLRQICEDHIKAQIHQ 331

  Fly    86 VMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGDKETYPIYRLAMIS 150
            ..|:.||.   :..:.|....|..:.|....:.......:|.:|.:..:...     |:.:.:..
Mouse   332 FREDSLDS---VLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYVLQNSMLPS-----IWDMGLEL 388

  Fly   151 WKELVFEPSVTILAAIRLILSQMPREYN---------KSL-----EYQVY------QVLQSIVEL 195
            ::..:..........|..||..:.||.|         :||     :.|:|      |.||....|
Mouse   389 FRAHIISDQKVQTKTIDGILLLIERERNGEAIDRSLLRSLLSMLSDLQIYQDSFEQQFLQETNRL 453

  Fly   196 YAND---KYQDVSLPS---RIDKIFTE---KVMDFYKSTTLHEFQKIVVSNDYKDFKHFLRYACL 251
            ||.:   ..|:..:|.   .::|...|   :::.:...||    ||.::::..|...        
Mouse   454 YAAEGQKLMQEREVPEYLHHVNKRLEEEADRLITYLDQTT----QKSLIASVEKQLL-------- 506

  Fly   252 AMPEIENGTQFKAILKRYLAARLQETRLSGKDYIQAFLGLCRGPLQRAL---------------- 300
                   |....|||::.|.:.|.|.|:.....:.......||.:|..|                
Mouse   507 -------GEHLTAILQKGLNSLLDENRIQDLSLLYQLFSRVRGGVQVLLQQWIEYIKAFGSTIVI 564

  Fly   301 ---RDHTKLAEVVDAVCKEEINRKGQIID---------------------------PTRLLVTYA 335
               :|.|.:.|::|  .|::::   .|||                           |..|:..|.
Mouse   565 NPEKDKTMVQELLD--FKDKVD---HIIDTCFLKNEKFINAMKEAFETFINKRPNKPAELIAKYV 624

  Fly   336 NELMTKRQESEEAIIDELKRIVKCV----EFLSDEYKFIDMYLKALRIRQINETSTSDGVESIMY 396
            :..:  |..::||..:||::::..:    .|:..:..|...|.|.|..|.:...|.|...|..|.
Mouse   625 DSKL--RAGNKEATDEELEKMLDKIMIIFRFIYGKDVFEAFYKKDLAKRLLVGKSASVDAEKSML 687

  Fly   397 SLLNKKMANFVTRCIYVQLRDVDKLRTLKKEFQDHLNSKGIK---------LGFDFRPKCFKNDG 452
            |.|..:.....|..:....:|::..:.:..:|:.::.::.:.         |...:.|       
Mouse   688 SKLKHECGAAFTSKLEGMFKDMELSKDIMIQFKQYMQNQNVPGNIELTVNILTMGYWP------- 745

  Fly   453 SFENFNLTLPDELQQAWKEFRIFY----EARKLQSKAII---QLNNELSSGEITCHLNQSVYILE 510
            ::....:.||.|:.:..:.|:.||    ..||||.::.:   .|..|...|:..         |:
Mouse   746 TYVPMEVHLPPEMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKE---------LQ 801

  Fly   511 VSTLQMAVLMLFNRHERFTEQELVTALGVELETLQEALKQI---KFLVYIEVNKVNYIE------ 566
            ||..|..||::||..|.|:.:|:..|.|:|...|:..|:.:   |..|..:..|...||      
Mouse   802 VSLFQTMVLLMFNEGEEFSLEEIKHATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFI 866

  Fly   567 INMDFTNRKRRLFCNEPLPRKMRK-IEEKSEIELKIRRDK--QVDAAIVRIMKGQKQLEYSELIS 628
            .|.||.::..|:..|:   .:|:: :||::....::.:|:  |:|||||||||.:|.|.::.|:|
Mouse   867 CNDDFKHKLFRIKINQ---IQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVS 928

  Fly   629 LVYEELKDRVKPQVSFIKKRLDYLVEREYLERD----NYYN 665
            .||.:||..|||  :.:|||::.|::|:|:|||    |.||
Mouse   929 EVYNQLKFPVKP--ADLKKRIESLIDRDYMERDKENPNQYN 967

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 169/757 (22%)
CULLIN 362..500 CDD:214545 30/154 (19%)
Cullin_Nedd8 606..661 CDD:287520 29/55 (53%)
Cul4bNP_001103612.1 Nuclear localization signal. {ECO:0000250|UniProtKB:Q13620} 112..115
Cullin 275..870 CDD:279260 126/645 (20%)
CULLIN 653..793 CDD:214545 29/147 (20%)
Cullin_Nedd8 899..964 CDD:214883 31/67 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.