DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and Cul5

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:XP_006243152.1 Gene:Cul5 RGDID:621742 Length:828 Species:Rattus norvegicus

Alignment Length:767 Identity:176/768 (23%)
Similarity:325/768 (42%) Gaps:140/768 (18%)


  Fly    11 FDSMLPLIDNILQVVNQIFDDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSDC 75
            :|.|.|:   :|:::.|     .|...|:...|:..::..|.    |::   |....::..|.:.
  Rat    94 WDFMRPI---VLKLLRQ-----ESVTKQQWFDLFSDVHAVCL----WDD---KGSSKIHQALKED 143

  Fly    76 LMKRLKNI-AWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERE--RLKGD 137
            :::.:|.. |.|:.:| ||.   .|:..|:..|..:...|:.|...........:.::  ..|.:
  Rat   144 ILEFIKQAQARVLSHQ-DDT---ALLKAYIVEWRKFFTQCDILPKPFCQLEVTLLGKQSSNKKSN 204

  Fly   138 KETYPIYRLAMISWKELVFEPSVTIL--AAIRLI-LSQMPREYNKSLEYQVYQVLQSIVELYAN- 198
            .|...:.:|.:.:|.|.:|......|  :|::|: ..::...::..|   |..|.:|.|.|.:| 
  Rat   205 MEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQL---VIGVRESYVNLCSNP 266

  Fly   199 -DK---YQD---------------VSLPSRIDKIFTEKVMDF------------YKSTTLHEFQK 232
             ||   |:|               ...||.:.:...:..|.:            :|.|.|.|.|.
  Rat   267 EDKLQIYRDNFEKAYLDSTERFYRTQAPSYLQQNGVQNYMKYLMECCVNALVTSFKETILAECQG 331

  Fly   233 IVVSNDYKDFKHFLRYACLAMPEIENGTQ--FKAILKRYLAARL-------QETRLSGKDYIQAF 288
            ::..|:.:  |..|.::  .|.::..|.:  .|.:.:..::|.|       :......:.|::..
  Rat   332 MIKRNETE--KLHLMFS--LMDKVPGGIEPMLKDLEEHIISAGLADMVAAAETITTDSEKYVEQL 392

  Fly   289 LGLCR------------GPLQRALRDHTKLAEVVDA-VCKEEINRK----GQIIDP----TRLLV 332
            |.|..            .|.....||....|.|.|| :.|.|:..|    |....|    ..||.
  Rat   393 LTLFNRFSKLVKEAFQDDPRFLTARDKAYKAVVNDATIFKLELPLKQKGVGLKTQPESKCPELLA 457

  Fly   333 TYANELMTK----RQESEEAIIDELKRIVKCVEFLSDEYKFIDMYLKALRIRQINETSTSDGVES 393
            .|.:.|:.|    ::.:.|.|..:||.::..::::.::..|:..:...|..|.|.:.|....:|.
  Rat   458 NYCDMLLRKTPLSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEE 522

  Fly   394 IMYSLLNK--KMANFVTRCIYVQLRDVDKLRTLKKEFQD-HLNSKGIKLGFDFRPKCFKNDG--- 452
            .|...|.:  ..|::|.: :....:|:.....|.:.|:: |.|:| :.|..|.......|.|   
  Rat   523 NMVEWLREVGMPADYVNK-LARMFQDIKVSEDLNQAFKEMHKNNK-LALPADSVNIKILNAGAWS 585

  Fly   453 -SFENFNLTLPDELQQAWKEFRIFYEARKLQSKAIIQLNNELSSGEITCHLNQSVYILEVSTLQM 516
             |.|...::||.||:....|...||  :|..|...:..::.:|:|.||.......|.|||:|.|:
  Rat   586 RSSEKVFVSLPTELEDLIPEVEEFY--KKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQL 648

  Fly   517 AVLMLFNRHER----FTEQELVTAL-GVEL-ETLQE--ALKQIKFLVYIEVNKVN---------Y 564
            |||..:|:..|    |...:|.|.| ..|| .||..  |..::|..|.:...:||         .
  Rat   649 AVLFAWNQRPREKISFENLKLATELPDAELRRTLWSLVAFPKLKRQVLLYDPQVNSPKDFTEGTL 713

  Fly   565 IEINMDFT---NRK--RRLFCN-----EPLPRKMRKIEEKSEIELKIRRDKQVDAAIVRIMKGQK 619
            ..:|.||:   |.|  :|...|     :....:||:.|.:..::|:|.|.::   ||::|||.:|
  Rat   714 FSVNQDFSLIKNAKVQKRGKINLIGRLQLTTERMREEENEGIVQLRILRTQE---AIIQIMKMRK 775

  Fly   620 QLEYSELISLVYEELKDRVKPQVSFIKKRLDYLVEREYLERDNY-YNIYRYL 670
            ::..::|.:.:.|.||:...||...||:::::|:|.:|:.||.. .|.:.|:
  Rat   776 KISNAQLQTELVEILKNMFLPQKKMIKEQIEWLIEHKYIRRDEADINTFIYM 827

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 172/752 (23%)
CULLIN 362..500 CDD:214545 35/145 (24%)
Cullin_Nedd8 606..661 CDD:287520 18/55 (33%)
Cul5XP_006243152.1 Cullin 95..719 CDD:279260 143/654 (22%)
CULLIN 491..634 CDD:214545 35/147 (24%)
Cullin_Nedd8 761..820 CDD:287520 20/62 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.