DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and cul3b

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001177414.1 Gene:cul3b ZFINID:ZDB-GENE-081007-1 Length:766 Species:Danio rerio

Alignment Length:819 Identity:168/820 (20%)
Similarity:296/820 (36%) Gaps:233/820 (28%)


  Fly     5 KRISNYFDSMLPLIDNILQVVNQIFDDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLY 69
            |.::|.:|    |:.|.:|.:.:..:...||:     .||...|...         ..|:|..||
Zfish    27 KYVNNIWD----LLKNAIQEIQRKNNSGLSFE-----ELYRNAYTMV---------LHKHGEKLY 73

  Fly    70 IVLSDCLMKRLKN-IAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERER 133
            ..|.:.:.:.|.| :...:.|.|::|    .:....:.|..:|.:...:.....:.:|.:|::..
Zfish    74 TGLREVVTEHLINKVREDVLNSLNNN----FLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNN 134

  Fly   134 LKGDKETYPIYRLAMISWKELVFEPSVTILAAIR-----LILSQMPRE----------------- 176
            ::.      :|.|.:|     :|...|.....||     .:|..:.||                 
Zfish   135 VEN------VYNLGLI-----IFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNACQM 188

  Fly   177 -------------------------------------------YNKSLEYQVYQVLQSIVELYAN 198
                                                       |.|.:|.::.:.::.::..   
Zfish   189 LMILGLEGRSVYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEARINEEIERVIHC--- 250

  Fly   199 DKYQDVSLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVSNDYKDFKHFLR------YACL--AMPE 255
                       :||...|.::...:...:.:..|.:|..:.....|.|:      .||:  ....
Zfish   251 -----------LDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLACMYKLFSR 304

  Fly   256 IENGTQFKAILKRYLAARLQETRLSGK-------------DYIQAFLGLCRGPLQRALRDHTKLA 307
            :.||      ||..........|..||             ||||..|.| :....|.|::...  
Zfish   305 VPNG------LKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDL-KSRFDRFLQESFN-- 360

  Fly   308 EVVDAVCKEEI----------NRKGQIIDPTRLLVTYANELMTK-----RQESEEAIIDELKRIV 357
              .|.:.|:.|          |.:.     ...|..:.::.:.|     .::..|:|:|:...:.
Zfish   361 --NDRLFKQTIAGDFEYFLNLNSRS-----PEYLSLFIDDKLKKGVKGLTEQEVESILDKAMVLF 418

  Fly   358 KCVEFLSDEYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLR 422
            :   |:.::..|...|.:.|..|.:...|.||..|..|.|.|..:.....|..:....||:....
Zfish   419 R---FMQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISN 480

  Fly   423 TLKKEFQDHLNSKGIKL-GFDF---------------RPKCFKNDGSFENFNLTLPDELQQAWKE 471
            |...||:.||.|.|:.| |.|.               .|||            .:|...:.|::.
Zfish   481 TTMDEFRQHLTSTGVSLGGVDLIVRVLTTGYWPTQSATPKC------------NIPPSPRHAFEV 533

  Fly   472 FRIFYEARKLQSKAIIQ-------LN------------NELSSGEITCHLNQSVYILEVSTLQMA 517
            ||.||.|:....:..:|       ||            :::..|......|...:||:|||.||.
Zfish   534 FRRFYLAKHSGRQLTLQHHMGSADLNATFYGPIKKEDGSDMVGGAQVTGSNTRKHILQVSTFQMT 598

  Fly   518 VLMLFNRHERFTEQELVTALGVELETLQEALKQI-----------KFLVYIEVNKVNYIEINMDF 571
            :|||||..|:.|.:|:.....:....|..||:.:           |.....|:...:...:|..|
Zfish   599 ILMLFNNREKSTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHVFTVNDQF 663

  Fly   572 TNRKRRLFCNEPLPRKMRKIEEKSEIELKIRRDK--QVDAAIVRIMKGQKQLEYSELISLVYEEL 634
            |:|..|:.......::.....|:.|...|:..|:  :::||||||||.:|:::::.|::.|.::|
Zfish   664 TSRLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQL 728

  Fly   635 KDRVKPQVSFIKKRLDYLVEREYLER---DNYYNIYRYL 670
            :.|..|....||||::.|:|||||.|   |.  .:|.|:
Zfish   729 RARFLPSPVVIKKRIEGLIEREYLARTPEDR--KVYTYV 765

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 162/798 (20%)
CULLIN 362..500 CDD:214545 39/173 (23%)
Cullin_Nedd8 606..661 CDD:287520 25/58 (43%)
cul3bNP_001177414.1 Cullin 34..662 CDD:279260 130/706 (18%)
CULLIN 420..562 CDD:214545 38/154 (25%)
Cullin_Nedd8 698..758 CDD:287520 25/60 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.