DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and cul4b

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001116316.1 Gene:cul4b ZFINID:ZDB-GENE-041008-208 Length:864 Species:Danio rerio

Alignment Length:761 Identity:169/762 (22%)
Similarity:309/762 (41%) Gaps:185/762 (24%)


  Fly    30 DDYTSFDGQKLM-----------------HLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSDCLM 77
            ::||:...|||.                 .||..:...|:     :..:.|..:.|.:|..|.:.
Zfish   161 ENYTNETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCS-----HKISAKLYKQLRVVCEDHIK 220

  Fly    78 KRLKNIAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGDKETYP 142
            .::...   .|:.||.   :..:.|..:.|..:.|....:.......:|.:|.:..:      .|
Zfish   221 AQIDQF---REDALDS---VLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYVLQNSM------LP 273

  Fly   143 --------IYRLAMISWKELVFEPSVTILAAIRLILSQMPREYNKSLEYQVYQVLQSIVELYAN- 198
                    ::|..:||  :|..: |.||...:.||      |..:|.|.....:|:|::.:.:: 
Zfish   274 SIWDMGLELFRFYIIS--DLKVQ-SKTIDGILLLI------ERERSGEAVDRSLLRSLLSMLSDL 329

  Fly   199 DKYQDVSLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVSNDYKDFKHFL-----RYACLAMPEIEN 258
            ..|||     ..::.|.|:....|.:    |.|:::...:..::.|.:     ..|...:..::.
Zfish   330 QIYQD-----SFEQRFLEETNRLYAA----EGQRLMQEREVPEYLHHVNKRLEEEADRVITYLDQ 385

  Fly   259 GTQ---------------FKAILKRYLAARLQETRLSGKDYIQAFLGLCRGPLQRAL-------- 300
            .||               ..|||::.|...|.|.|:.....:.......||.:|..|        
Zfish   386 STQKSLIATVEKQLLGEHLTAILQKGLNNLLDENRIQDLSLLYQLFSRVRGGVQVLLQHWIEYIK 450

  Fly   301 -----------RDHTKLAEVVD---------AVC--KEE-------------INRKGQIIDPTRL 330
                       :|.|.:.|::|         .||  |.|             ||::..  .|..|
Zfish   451 AFGSTIVINPEKDKTMVQELLDFKDKVDHIIDVCFMKNEKFVNGMKEAFETFINKRPN--KPAEL 513

  Fly   331 LVTYANELMTKRQESEEAIIDELKRIVKCV----EFLSDEYKFIDMYLKALRIRQINETSTSDGV 391
            :..|.:..:  |..::||..:||::::..:    .|:..:..|...|.|.|..|.:...|.|...
Zfish   514 IAKYVDSKL--RAGNKEATDEELEKMLDKIMIIFRFIYGKDVFEAFYKKDLAKRLLVGKSASVDA 576

  Fly   392 ESIMYSLLNKKMANFVTRCIYVQLRDVDKLRTLKKEFQDHLNSKGIK---------LGFDFRPKC 447
            |..|.|.|..:.....|..:....:|::..:.:..:|:.|:..:.|.         |...:.|  
Zfish   577 EKSMLSKLKHECGAAFTSKLEGMFKDMELSKDIMVQFKQHMQCQNIPGNIELTVNILTMGYWP-- 639

  Fly   448 FKNDGSFENFNLTLPDELQQAWKEFRIFY----EARKLQSKAII---QLNNELSSGEITCHLNQS 505
                 ::....:.||.|:.:..:.|:.||    ..||||.::.:   .|..|...|:..      
Zfish   640 -----TYVPMEVHLPAEMVRLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKE------ 693

  Fly   506 VYILEVSTLQMAVLMLFNRHERFTEQELVTALGVELETLQEALKQI---KFLVYIEVNKVNYIE- 566
               |:||..|..||::||..|.|:.:::..|.|:|...|:..|:.:   |..|..::.|...:| 
Zfish   694 ---LQVSLFQTLVLLMFNEGEEFSLEDIKLATGIEDSELRRTLQSLACGKARVLTKIPKSKDVED 755

  Fly   567 -----INMDFTNRKRRLFCNEPLPRKMRK-IEEKSEIELKIRRDK--QVDAAIVRIMKGQKQLEY 623
                 .|.||.::..|:..|:   .:|:: :||::....::.:|:  |:|||||||||.:|.|.:
Zfish   756 GDKFSCNDDFKHKLFRIKINQ---IQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSH 817

  Fly   624 SELISLVYEELKDRVKPQVSFIKKRLDYLVEREYLERD----NYYN 665
            :.|:|.||.:||..|||  :.:|||::.|::|:|:|||    |.||
Zfish   818 NLLVSEVYNQLKFPVKP--ADLKKRIESLIDRDYMERDKENPNQYN 861

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 169/762 (22%)
CULLIN 362..500 CDD:214545 32/154 (21%)
Cullin_Nedd8 606..661 CDD:287520 29/55 (53%)
cul4bNP_001116316.1 Cullin 169..764 CDD:279260 126/650 (19%)
CULLIN 547..687 CDD:214545 31/147 (21%)
Cullin_Nedd8 793..858 CDD:214883 31/67 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.