DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and cul3

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001015975.2 Gene:cul3 XenbaseID:XB-GENE-974982 Length:768 Species:Xenopus tropicalis

Alignment Length:794 Identity:170/795 (21%)
Similarity:301/795 (38%) Gaps:188/795 (24%)


  Fly    10 YFDSMLPLIDNILQVVNQIFDDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSD 74
            |.:|:..|:.|.:|.:.:..:...||:     .||...|...         ..|:|..||..|.:
 Frog    29 YVNSIWDLLKNAIQEIQRKNNSGLSFE-----ELYRNAYTMV---------LHKHGEKLYTGLRE 79

  Fly    75 CLMKRLKN-IAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGDK 138
            .:.:.|.| :...:.|.|::|    .:....:.|..:|.:...:.....:.:|.:|::..::.  
 Frog    80 VVTEHLINKVREDVLNSLNNN----FLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVEN-- 138

  Fly   139 ETYPIYRLAMISWKELVF---------------------EPSVTILAAIR------LILS----- 171
                :|.|.:|.:::.|.                     :..|....|||      :||.     
 Frog   139 ----VYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRS 199

  Fly   172 -----------QMPREY-----NKSLEYQVYQVLQSIVELYANDKYQDVSLPSRIDKIFTEKVMD 220
                       :|..|:     .|.|......|....||...|::.:.|.  ..:||...|.::.
 Frog   200 VYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEARINEEIERVM--HCLDKSTEEPIVK 262

  Fly   221 FYKSTTLHEFQKIVVSNDYKDFKHFLR------YACL--AMPEIENG----TQFKAILKRYLAAR 273
            ..:...:.:..|.:|..:.....|.|:      .||:  ....:.||    .:..::..|.....
 Frog   263 VVERELISKHMKTIVEMENSGLVHMLKNGKTEDLACMYKLFSRVPNGLKTMCECMSLYLREQGKA 327

  Fly   274 LQETRLSGK---DYIQAFLGLCRGPLQRALRDHTKLAEVVDAVCKEEI----------NRKGQII 325
            |......||   ||||..|.| :....|.|::...    .|.:.|:.|          |.:.   
 Frog   328 LVSEEGEGKNPVDYIQGLLDL-KSRFDRFLQESFS----NDRLFKQTIAGDFEYFLNLNSRS--- 384

  Fly   326 DPTRLLVTYANELMTK-----RQESEEAIIDELKRIVKCVEFLSDEYKFIDMYLKALRIRQINET 385
              ...|..:.::.:.|     .::..|:|:|:...:.:   |:.::..|...|.:.|..|.:...
 Frog   385 --PEYLSLFIDDKLKKGVKGLTEQEVESILDKAMVLFR---FMQEKDVFERYYKQHLARRLLTNK 444

  Fly   386 STSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRTLKKEFQDHLNSKGIKL-GFDF------ 443
            |.||..|..|.|.|..:.....|..:....||:....|...||:.||.:.|:.| |.|.      
 Frog   445 SVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNTTMDEFRQHLQTTGVSLGGVDLTVRVLT 509

  Fly   444 ---------RPKCFKNDGSFENFNLTLPDELQQAWKEFRIFYEARKLQSKAIIQLNNELSSGEIT 499
                     .|||            .:|...:.|::.||.||.|:  .|...:.|.:.:.|.::.
 Frog   510 TGYWPTQSATPKC------------NIPPAPRHAFEIFRRFYLAK--HSGRQLTLQHHMGSADLN 560

  Fly   500 CHL----------------------NQSVYILEVSTLQMAVLMLFNRHERFTEQELVTALGVELE 542
            ...                      |...:||:|||.||.:|||||..|::|.:|:.....:...
 Frog   561 ATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILMLFNNREKYTFEEIQQETDIPER 625

  Fly   543 TLQEALKQI-----------KFLVYIEVNKVNYIEINMDFTNRKRRLFCNEPLPRKMRKIEEKSE 596
            .|..||:.:           |.....|:...:...:|..||::..|:.......::.....|:.|
 Frog   626 ELVRALQSLACGKPTQRVLTKEPKSKEIESGHMFTVNDQFTSKLHRVKIQTVAAKQGESDPERKE 690

  Fly   597 IELKIRRDK--QVDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIKKRLDYLVEREYLE 659
            ...|:..|:  :::||||||||.:|:::::.|::.|.::||.|..|....||||::.|:|||||.
 Frog   691 TRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLA 755

  Fly   660 R---DNYYNIYRYL 670
            |   |.  .:|.|:
 Frog   756 RTPEDR--KVYTYV 767

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 165/778 (21%)
CULLIN 362..500 CDD:214545 37/154 (24%)
Cullin_Nedd8 606..661 CDD:287520 26/58 (45%)
cul3NP_001015975.2 Cullin 35..664 CDD:279260 132/682 (19%)
CULLIN 421..563 CDD:214545 37/156 (24%)
Cullin_Nedd8 700..760 CDD:287520 26/60 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.