DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and cul4a

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001015893.1 Gene:cul4a XenbaseID:XB-GENE-1014775 Length:753 Species:Xenopus tropicalis

Alignment Length:763 Identity:169/764 (22%)
Similarity:294/764 (38%) Gaps:182/764 (24%)


  Fly    30 DDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSDCLMKRLKNI------AWVME 88
            |.||....|||....:.|....:.:.|.....|.........:|..|.|:|:.:      |.:.:
 Frog    50 DSYTQDTWQKLQEAVNAIESSTSIKYNLEELYQAVENLCSYKVSHTLYKQLRQVCEEHMKAQIHQ 114

  Fly    89 NQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGDKETYP--------IYR 145
            .:.|.......:.|....|..:.|....:.......:|.:|.:..:      .|        ::|
 Frog   115 FREDSLDSFLFLKKVNRCWKDHCRQMIMIRSIFLFLDRTYVLQNSM------LPSIWDMGLELFR 173

  Fly   146 LAMISWKELVFEPSVTILAAIRLILSQ-----MPREYNKSL-----EYQVY------QVLQSIVE 194
            ..::|.:.:..:   ||...::||..:     :.|...:||     :.|||      :.|:....
 Frog   174 CHVVSDRMVQIK---TIDGILKLIEQERSGEAVDRSLLRSLLGMLSDLQVYKESFETKFLEETNC 235

  Fly   195 LYANDKYQDVSLPSRIDKIFTEKVMDFYKSTTLH--------EFQKIVVSNDYKDFKHFLRYACL 251
            |||.:.          .::..|:.:..|    ||        |..:::...|:...|..:  ||:
 Frog   236 LYAAEG----------QRLMQEREVPEY----LHHVNRRLEEEVDRVITYLDHGTHKPLI--ACV 284

  Fly   252 AMPEIENGTQFKAILKRYLAARLQE-------------TRLSG---------KDYIQAF-LGLCR 293
            ....:  |....|||::.|...|.|             :|:.|         .:||:.| .||..
 Frog   285 EKQLL--GEHLTAILQKGLKNMLDENRDPELTLMYQLFSRVKGGQIILLQHWGEYIKNFGSGLVI 347

  Fly   294 GP------LQRALRDHTKLAEVVDAVC-----------KEE----INRKGQIIDPTRLLVTYANE 337
            .|      :|..|.....:..::| ||           ||.    |||:..  .|..|:..|.:.
 Frog   348 NPEKDKDMVQELLDFKDNVDHIID-VCFQKNEKFVNTMKESFETFINRRAN--KPAELIAKYVDS 409

  Fly   338 LMTKRQESEEAIIDELKRIVKCV----EFLSDEYKFIDMYLKALRIRQINETSTSDGVESIMYSL 398
            .:  |..::||..:||:|::..:    .|:..:..|...|.|.|..|.:...|.|...|..|.|.
 Frog   410 KL--RSGNKEATDEELERLLDKIMIIFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDSEKSMLSK 472

  Fly   399 LNKKMANFVTRCIYVQLRDVDKLRTLKKEFQDHLNSKGIKLGFDFRPKCFKNDGSFENFNLT--- 460
            |..:.....|..:....:|::..:.:..:|:.|:                :|.....|.:||   
 Frog   473 LKHECGAAFTSKLEGMFKDMELSKDVMVQFKQHM----------------QNHSDPGNIDLTVNI 521

  Fly   461 ---------------LPDELQQAWKEFRIFYEARKLQSKAIIQLNNELSSGEITCHLNQSVYILE 510
                           ||.|:.:..:.|:.||..:  .|...:|..:.|....:.....:....|:
 Frog   522 LTMGYWPTYTPVDVHLPAEMVKLQEIFKAFYLGK--HSGRRLQWQSTLGHAVLKADFKEEKKELQ 584

  Fly   511 VSTLQMAVLMLFNRHERFTEQELVTALGVELETLQEALKQI---KFLVYIEVNKVNYIE------ 566
            ||..|..||:|||:.:.|..:|:....|:|...|:..|:.:   |..|..:..|...:|      
 Frog   585 VSLFQTLVLLLFNKGDEFGFEEIKITTGIEDNELRRTLQSLACGKARVLNKSPKSKDVEDGDRFC 649

  Fly   567 INMDFTNRKRRLFCNEPLPRKMRKIEEKSEIELKIR--------RDKQVDAAIVRIMKGQKQLEY 623
            .|.||.::..|:        |:.:|:.|..:|.::.        |..|:|||||||||.:|.|.:
 Frog   650 FNADFKHKLYRI--------KINQIQMKETVEEQVNTTERVFQDRQYQIDAAIVRIMKMRKTLTH 706

  Fly   624 SELISLVYEELKDRVKPQVSFIKKRLDYLVEREYLERD-NYYNIYRYL 670
            :.|:|.:|.:||..|||  ..:|||::.|::|:|:||| :....|.||
 Frog   707 NLLVSELYNQLKFPVKP--GDLKKRIESLIDRDYMERDKDNAKQYHYL 752

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 168/762 (22%)
CULLIN 362..500 CDD:214545 29/156 (19%)
Cullin_Nedd8 606..661 CDD:287520 28/55 (51%)
cul4aNP_001015893.1 Cullin 58..653 CDD:279260 126/645 (20%)
CULLIN 436..576 CDD:214545 29/158 (18%)
Cullin_Nedd8 682..747 CDD:214883 30/67 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.