DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and mr

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_611862.1 Gene:mr FlyBaseID:FBgn0002791 Length:802 Species:Drosophila melanogaster

Alignment Length:707 Identity:135/708 (19%)
Similarity:246/708 (35%) Gaps:194/708 (27%)


  Fly    17 LIDNILQVVNQIFDDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGR-----SLYIVLSDCL 76
            |....:..:|::.|.:     |.||.:...:.:...||   ..|..|..:     .:...|.|||
  Fly   103 LFTQFIDAINELHDSF-----QSLMQVKPRLIQLVGAE---TKPTAKTVKLMQEEGIKNCLRDCL 159

  Fly    77 MKRLKNIAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLA-------------CYHFNRNW 128
            :.           ||..|..:.:.|.|   ||.::...:..|||             |...|   
  Fly   160 LA-----------QLPPNFSVVVGAFY---WVHFKLFTKASNLALTTVDSDVFDELLCVGCN--- 207

  Fly   129 VERERLKGDKETYPIYRLAMISWKELVFEPSV-------TILAAIRLILSQ---------MPREY 177
            .|.|:....:.|..:.:..|     .:||.::       .:.|.|:|.:.:         ..|.:
  Fly   208 FEAEQCCCQRLTDMVNKTNM-----KLFEMNLIDRLTGSALTALIKLKIKEHISDTCMGIFDRSH 267

  Fly   178 NKSLEYQVYQVLQS-----IVELYANDKYQDVSLPSRIDKIFTEKVMDF----YKSTTLHEFQKI 233
            .|.||..:..|:.|     ..|..:.|...|:.:|..: |.|..|:..|    :..:.:.:|..|
  Fly   268 LKQLETWLSDVIMSWLTNIFTEWKSKDSISDIEVPESV-KSFKVKLTYFMYETFAQSVIGQFFSI 331

  Fly   234 VVSNDYKDFKHFLRYACLAMPEIENGTQFKAILKRYLAARLQETRLSGKDYIQAFLGLCRGPLQR 298
            ::  ||.|....:....:.|.:|:........|:..|.||:....::..|.:..::...     :
  Fly   332 II--DYPDSIPAIDDLKICMEKIDMRVYLTESLRNSLEARILHPGVNTMDILTGYVAAI-----K 389

  Fly   299 ALR--DHT-KLAEVVDAVCKEEINRKGQIIDPTRLLVTYANELMTKRQESEEAIIDELKR---IV 357
            |:|  |.| .:.|:|.|..|:.:.::.   |..|.:||...|      |....:.:||.:   |.
  Fly   390 AIRHLDSTGVILEMVTAPIKDYLRKRN---DTVRRVVTGLTE------EGPTDLSEELAKGETIK 445

  Fly   358 KCVEFLSDEYK-------------------------------------------FIDMYLKALRI 379
            :|.:..:||:.                                           |:..|...:..
  Fly   446 ECKDSGTDEFSNWENWQPDPFGIDASIMQYNSSRKMRSADIISMVVDIYGSKELFMTEYRNLMAD 510

  Fly   380 RQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRTLKKEFQDHLNSKGIKLG---F 441
            |.:.:...:...|.....||..:....:.....|.|:||    |..|....|::|.|.:..   |
  Fly   511 RLLAQLDFNSEKEIRNLELLKIRFGESLLHSCEVMLKDV----TDSKRINAHIHSDGDRTENQLF 571

  Fly   442 D---------FRPKCFKNDGSFENFNLTLPDELQQAWKEFRIFYEA----RKLQSKAII-QLNNE 492
            |         |.|       ||...:|.||:|::..:|::...|||    |.|..:.:. ::|.|
  Fly   572 DISSLIVSAQFWP-------SFNKESLQLPEEIENEFKKYTKAYEAYKGNRTLNWRTVTGRVNIE 629

  Fly   493 LSSGEITCHLNQSVYILEVSTLQMAVLMLFNRHERFTEQELVTALGVELETLQ------------ 545
            :..|:.|..       :.||.:...::..|.....:|.::|.:...|....|:            
  Fly   630 IEIGDRTME-------MVVSPILAVIIYHFQTKNEWTIEDLSSITKVPASALRRRLSFWQNHGLI 687

  Fly   546 -EALKQIKFLVYIEVNKVNYIEINMDFTNRKRRLFCNEPLPRKMRKIEEKSEIELKI 601
             |....|..|:..|..|..|.::::...:       .|.|...|....::.|.||::
  Fly   688 SETTPGIFTLLEKESEKSQYEDMSLAEAD-------EEDLESAMASASDQREEELQV 737

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 134/700 (19%)
CULLIN 362..500 CDD:214545 37/198 (19%)
Cullin_Nedd8 606..661 CDD:287520
mrNP_611862.1 CULLIN 494..632 CDD:214545 33/149 (22%)
APC2 741..800 CDD:198081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89229458
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.