DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and Cul5

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_651665.2 Gene:Cul5 FlyBaseID:FBgn0039632 Length:852 Species:Drosophila melanogaster

Alignment Length:733 Identity:159/734 (22%)
Similarity:283/734 (39%) Gaps:195/734 (27%)


  Fly    38 QKLM------HLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSDCLMKRLKNIAWVMENQLDDNKP 96
            :|||      |::|.|..:..........|::||                           |...
  Fly   214 RKLMLDSWNKHIFHDIKHRLQESAMKIVHAERNG---------------------------DAYD 251

  Fly    97 IRLIAKYLEHWVPYQRSCE-KLNLACYHFNRNW----VERERLKGDKE-------TYPIYRLAMI 149
            .:|:....|.:|....:.| ||.:...:|...:    ||..|||..::       .|..|..:.:
  Fly   252 AQLVVGVRESYVNLSSNAEDKLEIYRENFEMAYLKATVEFYRLKSAEQQQENGVLAYMKYADSKL 316

  Fly   150 SWKEL----VFEPS-----------VTILAAIRLILSQMP---REYNKSLEYQVYQVLQSI---- 192
            ..:|:    ..|||           |.|:..:..|:::.|   |:|.......:::::..:    
  Fly   317 REEEVRAKRYLEPSSFSILTYTLVNVLIVDHLNSIIAECPALIRDYETERLNLMFRLMDRVMHGV 381

  Fly   193 -VELYANDKYQDVSLPSRIDKIFTEKVM----DFYKSTTLHEFQKI--VVSNDYKDFKHFLRYAC 250
             ||....|..:.:......|.:...:|:    :.|....|..|.|.  :|.|.:.|...||....
  Fly   382 GVEPMMGDLQRHIMSAGLADMLSASEVITQDSEKYVERLLELFNKFSDLVRNAFNDDPRFLTARD 446

  Fly   251 LAMPEIENGTQ-FKAILKRYLAARLQETRLSGKDYIQAFLGLCRGPLQRALRDHTKLAEVVDAVC 314
            :|...:.|.|. ||..|...:|.|       |..|                       ...::.|
  Fly   447 IAFKTVVNDTSVFKMELPTSIANR-------GVKY-----------------------TAPESKC 481

  Fly   315 KEEINRKGQIIDPTRLLVTYANEL-----MTKRQESEEAIID-ELKRIVKCVEFLSDEYKFIDMY 373
            .|             ||..|.:.|     ::||..||:  || .|:.::..:::::::..|:..:
  Fly   482 PE-------------LLANYCDMLLRRTPLSKRLTSEQ--IDARLRDVLLVLKYVNNKDVFMRYH 531

  Fly   374 LKALRIRQINETST-SDGVESIMYSLLNKKM-ANFVTRCIYVQLRDVDKLRTLKKEFQDHLNSKG 436
            ...|..|.|..||. |:..|.|:..|....| |::|.|              |.:.|||      
  Fly   532 KVHLTRRLILGTSADSEKEEDIVEWLREVGMPADYVNR--------------LARMFQD------ 576

  Fly   437 IKLGFD----FRPKCFKND---------GSF----ENFNLTLPDELQQAWKEFRIFYEARKLQSK 484
            ||:..|    ||....::|         |::    |..:::||.||:....:...||  :|..|.
  Fly   577 IKVSEDLNTQFRTSISRHDAINIKILNAGAWARCSERVSVSLPIELEDYIPDVEEFY--KKKHSG 639

  Fly   485 AIIQLNNELSSGEITCHLNQSVYILEVSTLQMAVLMLFN--RHERFTEQELVTALGVELETLQEA 547
            ..:|..:.:|:|.||...|...|.|:|:|.|||||..:|  :|::.:.:.|..|..:....|:..
  Fly   640 RKLQWYHHMSNGTITFVNNFGRYDLDVTTFQMAVLFAWNQRQHDKISYENLRLATELPDPELRRT 704

  Fly   548 L----------KQIKFLVYIEVNK-VNYIEINMDFTNRKRRLFCNEPLPRKMRKIEEKSEIELKI 601
            |          |||..:....::. .::.|..|.:.|::..:..|....|: .|:.....::|..
  Fly   705 LWSLVAFPKIKKQILLMEPAAISSPKDFAENTMFYINQEFAIVKNGKSQRR-GKLNLIGRLQLST 768

  Fly   602 RRDKQVD-------------AAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIKKRLDYLV 653
            .|.:|.|             .||::|||.:|::..:.|...:.:.||:...|....||::|::|:
  Fly   769 ERSQQEDNQSIVQLRILRTQEAIIKIMKVRKRMNNAALQGELIDILKNMFLPSKKMIKEQLEWLI 833

  Fly   654 EREYLER-DNYYNIYRYL 670
            |.:|:.| |:..|::.|:
  Fly   834 ENKYMRRDDDDINMFIYV 851

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 159/732 (22%)
CULLIN 362..500 CDD:214545 39/157 (25%)
Cullin_Nedd8 606..661 CDD:287520 19/69 (28%)
Cul5NP_651665.2 Cullin 33..743 CDD:279260 132/623 (21%)
CULLIN 520..655 CDD:214545 39/157 (25%)
Cullin_Nedd8 779..846 CDD:214883 18/67 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89251477
eggNOG 1 0.900 E1_COG5647
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11932
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.