DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and cul1b

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_998660.1 Gene:cul1b ZFINID:ZDB-GENE-040426-2887 Length:774 Species:Danio rerio

Alignment Length:783 Identity:201/784 (26%)
Similarity:346/784 (44%) Gaps:163/784 (21%)


  Fly    25 VNQIFDD--------YT--SFDGQKLMHLYHLIYKQCAAERN-------WNNPAQKN-------- 64
            :.||:||        ||  |....:.|.||..:|..|.:...       .:.|::|.        
Zfish    17 LEQIWDDLRSGIQQVYTRQSMARSRYMELYTHVYNYCTSVHQARPTGIPSSKPSKKTPTPGGAQF 81

  Fly    65 -GRSLYIVLSDCLMKRLKNIAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNW 128
             |..||..|.|.|...|.|:....|:.:|::    ::..|.:.|..|:.|.:.|:..|.:.||:|
Zfish    82 VGLELYKRLKDFLRSYLTNLLKDGEDLMDES----VLKFYTQQWEDYRFSSKVLDGICAYLNRHW 142

  Fly   129 VERERLKGDKETYPIYRLAMISWKELVFEP---SVTILAAIRLI--------------------- 169
            |.||..:|.|..|.||.||:.:|:|.:|.|   .|| .|.::|:                     
Zfish   143 VRRECDEGRKGIYEIYSLALATWRECLFRPLNKQVT-NAVLKLVEKERNGETINTRLVSGVVQSY 206

  Fly   170 -------------------------------------------LSQMP-REYNKSLEYQVYQVLQ 190
                                                       |.|.| .||.|..|.::.:. |
Zfish   207 VELGLNEDDAFVKGPTLSVYKEYFEAQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEE-Q 270

  Fly   191 SIVELYANDKYQDVSLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVSNDYKDFKHFLRYACLAMPE 255
            ..|::|.::..|| .|..:.:::..||.::.:.:    |||.::.::..:|......    .:..
Zfish   271 RRVQVYLHESTQD-ELARKCEQVLIEKHLEIFHT----EFQNLLDADKNEDLGRMYN----LVSR 326

  Fly   256 IENGT-QFKAILKRY-----LAA--RLQETRLSG-KDYIQAFLGLCR---GPLQRALRDHTKLAE 308
            |.:|. :.|.:|:.:     |||  :..::.|:. |.|:|..|.:.:   ..:..|..:......
Zfish   327 ITDGLGELKKLLESHIHNQGLAAIEKCGDSALNDPKMYVQTTLDVHKKYNALVMSAFNNDAGFVA 391

  Fly   309 VVDAVCKEEIN-----RKGQIIDPT-RLLVTYANELMTKRQES-EEA-IIDELKRIVKCVEFLSD 365
            .:|..|...||     |..|....: .||..|.:.|:.|..:: ||| :.|.|.:::...:::.|
Zfish   392 ALDKACGRFINNNAVTRMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIED 456

  Fly   366 EYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRTLKKEFQD 430
            :..|...|.|.|..|.:::.|.||..|:.|.|.|.:......|..:....:|:...:.|.::|:.
Zfish   457 KDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKK 521

  Fly   431 HL-NSKGIKLGFDFRPKCFKNDGSF---ENFNLTLPDELQQAWKEFRIFYEARKLQSKAIIQLNN 491
            || ||:.:.|.|..:   ..:.||:   ::....||.||:::::.|..||.:|....|  :....
Zfish   522 HLSNSEPLDLDFSIQ---VLSSGSWPFQQSCTFALPSELERSYQRFTAFYGSRHSGRK--LTWLY 581

  Fly   492 ELSSGEITCHLNQSVYILEVSTLQMAVLMLFNRHERFTEQELVTALGVELETLQEALK---QIKF 553
            .||.||:..:..::.|.|:.||.|||:|:.||....::.|:|..:..::.:.|.:.|:   :.|.
Zfish   582 HLSKGELVTNCFKNRYTLQASTFQMAILLQFNTENCYSVQQLADSTQIKTDILVQVLQILLKSKL 646

  Fly   554 LVYIEVNKVN----------YIEINMDFTNRKRRLFCNEPLPRKMRKIEEKSEIEL---KIRRDK 605
            || :|....|          .|::.:.:.|:|.|:..|.|:     |.|:|.|.|.   .|..|:
Zfish   647 LV-LEDENANIDEMDFKPDTLIKLFLGYKNKKLRVNINVPM-----KTEQKQEQETTHKNIEEDR 705

  Fly   606 Q--VDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIKKRLDYLVEREYLER-DNYYNIY 667
            :  :.||||||||.:|.|::.:|::.|..:|..|.||:|..|||.:|.|:|:||||| |...:.|
Zfish   706 KLLIQAAIVRIMKMRKVLKHQQLLAEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTY 770

  Fly   668 RYL 670
            .||
Zfish   771 SYL 773

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 200/782 (26%)
CULLIN 362..500 CDD:214545 38/142 (27%)
Cullin_Nedd8 606..661 CDD:287520 28/58 (48%)
cul1bNP_998660.1 Cullin 22..660 CDD:279260 154/659 (23%)
CULLIN 453..588 CDD:214545 38/140 (27%)
Cullin_Nedd8 701..768 CDD:214883 31/67 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.