DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and cul4a

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_957321.1 Gene:cul4a ZFINID:ZDB-GENE-040426-1357 Length:635 Species:Danio rerio

Alignment Length:646 Identity:119/647 (18%)
Similarity:230/647 (36%) Gaps:160/647 (25%)


  Fly     2 NRVKRISNYF-DSMLPLIDNILQVVNQIFDDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNG 65
            :|.|...:|. |:.|.|.|.:..:.|.....|      .|..||..:...|:.:           
Zfish    35 DRPKLTDSYTEDTWLKLRDAVSAIQNSTSIQY------NLEELYQAVENLCSYK----------- 82

  Fly    66 RSLYIVLSDCLMKRLKNIA---------WVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLAC 121
                  :|..|.|:|:.:.         ...|..||.   :..:.:....|..:.|....:....
Zfish    83 ------VSPMLYKQLRQVCEEHVQAQIHQFREESLDS---LSFLKRMNRCWQDHCRQTIMIRSIF 138

  Fly   122 YHFNRNWVERERLKGDKETYPIYRLAMISWKELVFEPSVTILAAIRLILSQMPREYNKSLEYQVY 186
            ...:|.:|.:..|...     |:...:..::..:...:......::.||.|:.||  :|.|....
Zfish   139 LFLDRTYVLQNSLLPS-----IWDTGLELFRTHIVSDAAVQSRTVQGILEQVERE--RSGETVDR 196

  Fly   187 QVLQSIVELYAN-DKYQDVSLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVSNDYKDFKHFLRYAC 250
            .:|:|::.:.:: ..|:|     ..::.|..:....|.:    |.|:::...|..::.|.:....
Zfish   197 SLLRSLLGMLSDLQVYKD-----SFEQRFLSETTRLYAA----EGQRLMQERDVPEYLHHVARRL 252

  Fly   251 LAMPEIEN------------------------GTQFKAILKRYLAARLQETRLSGKDYIQAFLGL 291
                |.||                        |.....||::.|...|.|.|:.....:......
Zfish   253 ----EEENDRVISYLDQSTQKPLIATVEKQLLGEHMTTILQKGLRTLLDENRVCELTLLYELFSK 313

  Fly   292 CRGPLQRALRDHTKLAEVVDA--VCKEEINRK--GQIID-------------------------- 326
            .:|.|...|:...:..:.|.|  ||..|.:|:  .:::|                          
Zfish   314 VKGGLTALLQSWREYIKSVGAETVCSPERDREMVQELLDFKDQMDSVTQSCFQRNESFINAMKEA 378

  Fly   327 -----------PTRLLVTYANELMTKRQESEEAIIDELKRIVKCV----EFLSDEYKFIDMYLKA 376
                       |..|:..|.:..:  |..::||..:||:||:..:    .|:..:..|...|.|.
Zfish   379 FENFINQRPNKPAELIAKYVDSKL--RAGNKEATEEELERILDKIMIIFRFIHGKDVFEAFYKKD 441

  Fly   377 LRIRQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRTLKKEFQDHLNSK----GI 437
            |..|.:...|.|...|..|.|.|..:.....|..:....:|::..:.:..:|:.::.::    .|
Zfish   442 LAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKDMELSKDIMIQFKQYMQNQTEPSNI 506

  Fly   438 KLGFD-----FRPKCFKNDGSFENFNLTLPDELQQAWKEFRIFY----EARKLQSKAII---QLN 490
            :|..:     :.|       |:...::.||.|:.:..:.|::||    ..||||.:..:   .|.
Zfish   507 ELTVNILTMGYWP-------SYTPMDVHLPAEMVKLQEVFKLFYLGKHSGRKLQWQPTLGHAVLK 564

  Fly   491 NELSSGEITCHLNQSVYILEVSTLQMAVLMLFNRHERFTEQELVTALGVELETLQEALKQI 551
            .|...|:..         |:||..|..||::||..:..:.:|:..|.|:|...|:..|:.:
Zfish   565 TEFKEGKKE---------LQVSLFQTLVLLMFNESDECSVEEIRVATGIEEGELKRTLQSL 616

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 112/623 (18%)
CULLIN 362..500 CDD:214545 32/154 (21%)
Cullin_Nedd8 606..661 CDD:287520
cul4aNP_957321.1 Cullin 50..635 CDD:279260 114/632 (18%)
CULLIN 427..567 CDD:214545 31/147 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.