DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and AT1G43140

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_175007.2 Gene:AT1G43140 AraportID:AT1G43140 Length:721 Species:Arabidopsis thaliana

Alignment Length:758 Identity:171/759 (23%)
Similarity:309/759 (41%) Gaps:180/759 (24%)


  Fly    25 VNQIFDDYTS--FDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSDCLMKRLKNIA--W 85
            :.:|.:|.:.  ||..:.::||.:||..|..:     |.....:.||        .:.:.:.  :
plant    31 LQRILEDLSEPPFDPGQYINLYTIIYDMCLQQ-----PPNDYSQELY--------NKYRGVVDHY 82

  Fly    86 VMENQLDDNKPIR---LIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGDKETYPIYRLA 147
            ..|..|...:...   ::.:.::.|..::.....|:..|::.:|.:|.|..|.      .:..:.
plant    83 NKETVLPSMRERHGEYMLRELVKRWANHKILVRWLSRFCFYLDRFYVARRGLP------TLNDVG 141

  Fly   148 MISWKELVFEPSVTILAAIRLILSQMPRE--------------------------YNKSLEYQVY 186
            ..|:.:||::...:....:.|.|....||                          |.:..|..:.
plant   142 FTSFHDLVYQEIQSEAKDVLLALIHKEREGEQIDRTLVKNVIDVYCGNGVGQMVIYEEDFESFLL 206

  Fly   187 QVLQSIVELYANDKYQDVSLPS---------RIDKIFTEKVMDFYKSTT----LHEFQK---IVV 235
            |...|.....|:...|:.|.|.         :::|   |:|.::..|||    :.:.|.   :||
plant   207 QDTASYYSRKASRWSQEDSCPDYMLKAEECLKLEK---ERVTNYLHSTTEPKLVEKVQNELLVVV 268

  Fly   236 SNDYKDFKHFLRYACLAMPE----------------IENGTQ-----FK--------AILKRYL- 270
            :....:.:|   ..|||:..                |..|.:     ||        |::|:.. 
plant   269 AKQLIENEH---SGCLALLRDDKMGDLSRMYRLYRLIPQGLEPIADLFKQHVTAEGNALIKQAAD 330

  Fly   271 AARLQETRLSG---------KDYIQAFLGLCRGPLQRALRDHTKLAEVVDAVCKEEINRKGQIID 326
            ||..|:...|.         .|....::..|   .|:....|..|.|..:..|.:.:.....   
plant   331 AATNQDASASQVLVRKEIELHDKYMVYVDEC---FQKHSLFHKLLKEAFEVFCNKTVAGASS--- 389

  Fly   327 PTRLLVTYANELMTKRQESEEAIIDE-----LKRIVKCVEFLSDEYKFIDMYLKALRIRQINETS 386
             ..:|.||.:.::..|..||: :.||     |:::|..:.::||:..|.:.|.|....|.:.:.|
plant   390 -AEILATYCDNILKTRGGSEK-LSDEATEITLEKVVNLLVYISDKDLFAEFYRKKQARRLLFDRS 452

  Fly   387 TSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRTLKKEFQDHLNSK-GIKLGFDFRPKCFKN 450
            .                       |..::.|:...|.|:..|.|:|::. ..|||.||.......
plant   453 G-----------------------IMKEVTDITLARELQTNFVDYLSANMTTKLGIDFTVTVLTT 494

  Fly   451 D--GSFENFNLTLPDELQQAWKEFRIFYEARKLQSKAIIQLNNELSSGEITCHL----NQSVYIL 509
            .  .|::..:|.||.|:....:.|::|| ..|..|:   :|:...|.|  |||:    .:....|
plant   495 GFWPSYKTTDLNLPTEMVNCVEAFKVFY-GTKTNSR---RLSWIYSLG--TCHILGKFEKKTMEL 553

  Fly   510 EVSTLQMAVLMLFNRHERFTEQELVTALGV---ELETLQEALKQIKFLVYIE------VNKVNYI 565
            .|||.|.|||:|||..||.:..|:...|.:   :|..|..:|..:|:.:.|:      ::|.:..
plant   554 VVSTYQAAVLLLFNNAERLSYTEISEQLNLSHEDLVRLLHSLSCLKYKILIKEPMSRTISKTDTF 618

  Fly   566 EINMDFTNRKRRLFCNEPLPRKMRKIEEKSEIELKIRRDKQ--VDAAIVRIMKGQKQLEYSELIS 628
            |.|..||::.|::  ..|||    .::|:.::...:.:|::  :|||:|||||.:|.|.:.:|:|
plant   619 EFNSKFTDKMRKI--RVPLP----PMDERKKVVEDVDKDRRYAIDAALVRIMKSRKVLAHQQLVS 677

  Fly   629 LVYEELKDRVKPQVSFIKKRLDYLVEREYLERD-NYYNIYRYL 670
            ...|.|....||.:..||||::.|:.|:||||| ...|.::|:
plant   678 ECVEHLSKMFKPDIKMIKKRIEDLINRDYLERDTENANTFKYV 720

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 171/757 (23%)
CULLIN 362..500 CDD:214545 33/141 (23%)
Cullin_Nedd8 606..661 CDD:287520 26/57 (46%)
AT1G43140NP_175007.2 Cullin 48..623 CDD:279260 130/637 (20%)
CULLIN 428..546 CDD:214545 35/147 (24%)
Cullin_Nedd8 653..713 CDD:287520 27/60 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.