DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul6 and Cacul1

DIOPT Version :10

Sequence 1:NP_648620.1 Gene:Cul6 / 39474 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001402930.1 Gene:Cacul1 / 365493 RGDID:1308127 Length:377 Species:Rattus norvegicus


Alignment Length:234 Identity:50/234 - (21%)
Similarity:92/234 - (39%) Gaps:51/234 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   449 KNDGSFENFNLTLPDELQQAWKEFRIFYEARKLQS---KAIIQLNNELSSGE----ITCHLNQSV 506
            |.||:.:......|.:.      ..|.||  ::.|   |.:.|.::|....:    ||.||.:..
  Rat   147 KLDGAIDQLLTQSPGDY------IPISYE--QIYSCVYKCVCQQHSEQMYSDLIKKITSHLERVS 203

  Fly   507 YILEVSTLQMAVLMLFNRHERFTEQELVTALGVELETLQEALKQIKFLVYIEVNKVNYIE--INM 569
            ..|:.|...:.:       |||.     .|||..:..||..:.     ::|.:||. |||  :|.
  Rat   204 KELQASPPDLYI-------ERFN-----IALGQYMGALQSIVP-----LFIYMNKF-YIETKLNR 250

  Fly   570 DFTNRKRRLFCNEPLPRK-----MRKIEEKSEIELKIRRDKQVDAAIVRIMKGQKQL--EYSELI 627
            |..:...:|| .|.:..|     |..:.|......::     ..:.:..|:||...|  |:.::.
  Rat   251 DLKDDLIKLF-TEHVAEKHIYSLMPLLLEAQSTPFQV-----TPSTMANIVKGLYTLRPEWVQMA 309

  Fly   628 SLVYEELKDRVKPQVSFIKKRL-DYLVEREYLERDNYYN 665
            ..::.:....:.|..  ::..| :|..:.:.|:|:...|
  Rat   310 PTLFSKFIPNILPPA--VESELSEYAAQDQKLQRELIQN 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 50/234 (21%)
Cacul1NP_001402930.1 Cullin 145..>269 CDD:459983 37/148 (25%)

Return to query results.
Submit another query.