| Sequence 1: | NP_648620.1 | Gene: | Cul6 / 39474 | FlyBaseID: | FBgn0036332 | Length: | 670 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006231740.1 | Gene: | Cacul1 / 365493 | RGDID: | 1308127 | Length: | 377 | Species: | Rattus norvegicus |
| Alignment Length: | 234 | Identity: | 50/234 - (21%) |
|---|---|---|---|
| Similarity: | 92/234 - (39%) | Gaps: | 51/234 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 449 KNDGSFENFNLTLPDELQQAWKEFRIFYEARKLQS---KAIIQLNNELSSGE----ITCHLNQSV 506
Fly 507 YILEVSTLQMAVLMLFNRHERFTEQELVTALGVELETLQEALKQIKFLVYIEVNKVNYIE--INM 569
Fly 570 DFTNRKRRLFCNEPLPRK-----MRKIEEKSEIELKIRRDKQVDAAIVRIMKGQKQL--EYSELI 627
Fly 628 SLVYEELKDRVKPQVSFIKKRL-DYLVEREYLERDNYYN 665 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Cul6 | NP_648620.1 | COG5647 | 25..670 | CDD:227934 | 50/234 (21%) |
| CULLIN | 362..500 | CDD:214545 | 12/57 (21%) | ||
| Cullin_Nedd8 | 606..661 | CDD:287520 | 9/57 (16%) | ||
| Cacul1 | XP_006231740.1 | Cullin | 146..>264 | CDD:279260 | 36/143 (25%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5647 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||