DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and Cul1

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:XP_006236471.1 Gene:Cul1 RGDID:1308157 Length:777 Species:Rattus norvegicus

Alignment Length:771 Identity:194/772 (25%)
Similarity:335/772 (43%) Gaps:168/772 (22%)


  Fly    25 VNQIFDD--------YT--SFDGQKLMHLYHLIYKQCAAERNWNN------PAQKN--------- 64
            ::||:||        ||  |....:.|.||..:|..|.:....|.      |..|:         
  Rat    17 LDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPGGA 81

  Fly    65 ---GRSLYIVLSDCLMKRLKNIAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNR 126
               |..||..|.:.|...|.|:....|:.:|::    ::..|.:.|..|:.|.:.||..|.:.||
  Rat    82 QFVGLELYKRLKEFLKNYLTNLLKDGEDLMDES----VLKFYTQQWEDYRFSSKVLNGICAYLNR 142

  Fly   127 NWVERERLKGDKETYPIYRLAMISWKELVFEP---SVT--ILAAI-----------RLI------ 169
            :||.||..:|.|..|.||.||:::|::.:|.|   .||  :|..|           |||      
  Rat   143 HWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQS 207

  Fly   170 --------------------------------------------LSQMP-REYNKSLEYQVYQVL 189
                                                        |.|.| .||.|..|.::.:. 
  Rat   208 YVELGLNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEE- 271

  Fly   190 QSIVELYANDKYQDVSLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVSNDYKDFKHFLRYACLAMP 254
            |..|::|.::..|| .|..:.:::..||.::.:.:    |||.::.::..:|......    .:.
  Rat   272 QRRVQVYLHESTQD-ELARKCEQVLIEKHLEIFHT----EFQNLLDADKNEDLGRMYN----LVS 327

  Fly   255 EIENGT-QFKAILKRY-----LAA--RLQETRLSG-KDYIQAFLGLCR---GPLQRALRDHTKLA 307
            .|::|. :.|.:|:.:     |||  :..|..|:. |.|:|..|.:.:   ..:..|..:.....
  Rat   328 RIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFV 392

  Fly   308 EVVDAVCKEEINRKG------QIIDPTRLLVTYANELMTKRQES-EEA-IIDELKRIVKCVEFLS 364
            ..:|..|...||...      .......||..|.:.|:.|..:: ||| :.|.|.:::...:::.
  Rat   393 AALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIE 457

  Fly   365 DEYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRTLKKEFQ 429
            |:..|...|.|.|..|.:::.|.||..|:.|.|.|.:......|..:....:|:...:.|.::|:
  Rat   458 DKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFK 522

  Fly   430 DHL-NSKGIKLGFDFRPKCFKNDGSF---ENFNLTLPDELQQAWKEFRIFYEARKLQSKAIIQLN 490
            .|| ||:.:.|.|..:   ..:.||:   ::....||.||:::::.|..||.:|....|  :...
  Rat   523 KHLTNSEPLDLDFSIQ---VLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRK--LTWL 582

  Fly   491 NELSSGEITCHLNQSVYILEVSTLQMAVLMLFNRHERFTEQELVTALGVELETLQEALK---QIK 552
            .:||.||:..:..::.|.|:.||.|||:|:.:|..:.:|.|:|..:..::::.|.:.|:   :.|
  Rat   583 YQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSK 647

  Fly   553 FLVYIEVN-KVNYIEINMD--------FTNRKRRLFCNEPLPRKMRKIEEKSEIEL---KIRRDK 605
            .||..:.| .|:.:|:..|        :.|:|.|:..|.|:     |.|:|.|.|.   .|..|:
  Rat   648 LLVLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPM-----KTEQKQEQETTHKNIEEDR 707

  Fly   606 Q--VDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIK--------KRLDY 651
            :  :.||||||||.:|.|::.:|:..|..:|..|.||:|..||        :||.|
  Rat   708 KLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKVPPSEAFPRRLPY 763

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 194/772 (25%)
CULLIN 362..500 CDD:214545 38/142 (27%)
Cullin_Nedd8 606..661 CDD:287520 22/57 (39%)
Cul1XP_006236471.1 Cullin 22..660 CDD:279260 156/657 (24%)
CULLIN 455..590 CDD:214545 38/140 (27%)
Cullin_Nedd8 703..>750 CDD:214883 20/47 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
43.970

Return to query results.
Submit another query.