DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and Cul2

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:XP_006254134.1 Gene:Cul2 RGDID:1310644 Length:745 Species:Rattus norvegicus

Alignment Length:791 Identity:158/792 (20%)
Similarity:309/792 (39%) Gaps:178/792 (22%)


  Fly     1 MNRVKRISNYFDSMLPLIDNILQVV----------NQIFDDYTSFDGQKLMHLYHLIYKQCAAER 55
            |:...|:.::.::...|:..|..||          |..|.|               ||..|.|  
  Rat     1 MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSD---------------IYALCVA-- 48

  Fly    56 NWNNPAQKNGRSLYIVLSDCLMKRLKNI-AWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNL 119
             :..|.   |..||......|...:::: ..|:|::      .:::..|..:|..|.:..:.::.
  Rat    49 -YPEPL---GERLYAETKIFLENHVRHLYKRVLESE------EQVLVMYHRYWEEYSKGADYMDC 103

  Fly   120 ACYHFNRNWVERERLKGDKETY------------PIYRLAMISWKELVFEPSVTILAAIRLILSQ 172
            ...:.|..::::.:|......|            .|..||:..|::|:.||...||  ||::|.:
  Rat   104 LYRYLNTQYIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQNIL--IRMLLRE 166

  Fly   173 MP-----------------------REYNKSLEYQVYQ------VLQSIVELY---ANDKYQDVS 205
            :.                       .:|.|....:.||      .|....|.|   |::..|:.:
  Rat   167 IKNDRGGEDPNQKVIHGVINSFVHVEQYKKKFPLKFYQGIFVSPFLTETGEYYKQEASNLLQESN 231

  Fly   206 LPSRIDKIFTEKVMDFYK---------------STTLHEFQKIVVSNDYKDFKHFLRYAC--LAM 253
            ...     :.|||:...|               :..:||.|:.:|:    |...||...|  :..
  Rat   232 CSQ-----YMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVA----DHLQFLHSECHSIIR 287

  Fly   254 PEIENGTQFKAILKRYLAARL-----QETRLSGKDYIQAFLGLCRGPL-----QRALRDHTKLAE 308
            .|.:|......:|.|.:::.|     :..|....:.::|...|.:..:     :..|..|.|..:
  Rat   288 HERKNDMANMYVLLRAVSSGLPHMIEELQRHIHDEGLRATSNLTQEHMPTLFVESVLEVHGKFVQ 352

  Fly   309 VVDAVCKEE--------------INRK--GQIIDPTRLLVTYANELMTKRQE--SEEAIIDELKR 355
            :::.|...:              :|.:  ..:.....||..|.:.|:.|..:  :|..:.|:|..
  Rat   353 LINTVLNGDQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDKLTS 417

  Fly   356 IVKCVEFLSDEYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDK 420
            .:...:::.|:..|...|.:.|..|.|:..|.|...|..|.:.|.:......|..::....|:..
  Rat   418 FITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSV 482

  Fly   421 LRTLKKEFQDHLNSKG--IKLGFDFR---------PKCFKNDGSFENFNLTLPDELQQAWKEFRI 474
            ...|..:|.:.:.::.  |.||..|:         |.......:|     .:|.||:::.:.|.:
  Rat   483 SADLNNKFNNFIRNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTF-----AIPQELEKSVQMFEL 542

  Fly   475 FYEARKLQSKAIIQLNNELSSGEITCHLNQSVYILEVSTLQMAVLMLFNRHERFTEQELVTALGV 539
            || ::....:.:..| :.|.:||:..:.....|:..|:|.|||||:.||..|..:.:||..:..:
  Rat   543 FY-SQHFSGRKLTWL-HYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQM 605

  Fly   540 ELETLQEALKQIKFLVYIEVNKVNY------------IEINMDFTNRKRRLFCNEPLPRKMRKIE 592
            ..:.|.:.:|.:     ::|..:|:            ..:||.|::::.:......:.:...:..
  Rat   606 NEKELTKTIKSL-----LDVKMINHDSEKEDIDAESSFSLNMSFSSKRTKFKITTSMQKDTPQEL 665

  Fly   593 EKSEIELKIRRDKQVDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIKKRLDYLVEREY 657
            |::...:...|...:.||||||||.:|.|.::.||..|..:.:.|..|.:|.|||.::.|::::|
  Rat   666 EQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQY 730

  Fly   658 LER-----DNY 663
            :||     |.|
  Rat   731 IERSQASADEY 741

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 153/768 (20%)
CULLIN 362..500 CDD:214545 31/149 (21%)
Cullin_Nedd8 606..661 CDD:287520 23/60 (38%)
Cul2XP_006254134.1 Cullin 30..643 CDD:279260 124/663 (19%)
CULLIN 424..568 CDD:214545 31/151 (21%)
Cullin_Nedd8 672..739 CDD:214883 24/67 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.