DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and Cul4a

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001120773.1 Gene:Cul4a RGDID:1563853 Length:759 Species:Rattus norvegicus

Alignment Length:753 Identity:164/754 (22%)
Similarity:290/754 (38%) Gaps:162/754 (21%)


  Fly    30 DDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSDCLMKRLKNI------AWVME 88
            |:||....:||......|....:...|.....|.........:|..|.|:|:.:      |.::.
  Rat    56 DNYTQDTWRKLHEAVKAIQSSTSIRYNLEELYQAVENLCSHKVSPTLYKQLRQVCEDHVQAQILP 120

  Fly    89 NQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGDKETYPIYRLAMISWKE 153
            .:.|....:..:.|....|..:.|....:.......:|.:|.:..:...     |:.:.:..::.
  Rat   121 FREDSLDSVLFLKKINTCWQDHCRQMIMIRSIFLFLDRTYVLQNSMLPS-----IWDMGLELFRN 180

  Fly   154 LVFEPSVTILAAIRLILSQMPRE-----YNKSL---------EYQVY------QVLQSIVELYAN 198
            .:....:.....|..||..:.||     .::||         :.|||      :.|:....|||.
  Rat   181 HIISDRMVQSKTIDGILLLIGRERSGEAVDRSLLRSLLSMLSDLQVYKDSFELKFLEETNCLYAA 245

  Fly   199 D---KYQDVSLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVSNDYKDFKHFLRYACLAMPEIENGT 260
            :   ..||..:|..::.:  .|.::       .|..:::...|:...|..:  ||:....:  |.
  Rat   246 EGQRLMQDREVPEYLNHV--SKRLE-------EEADRVITYLDHSTQKPLI--ACVEKQLL--GE 297

  Fly   261 QFKAILKRYLAARLQETRLSGKDYIQAFLGLCRGPLQRALRDH---------------------- 303
            ...|||::.|...|.|.|:.....:.......:|. |.||..|                      
  Rat   298 HLTAILQKGLEQLLDENRVPDLTQMYQLFSRVKGG-QHALLQHWSEYIKTFGTTIVINPEKDKDM 361

  Fly   304 --------TKLAEVVDAVC-----------KEE----INRKGQIIDPTRLLVTYANELMTKRQES 345
                    .|:..||: ||           ||.    ||::..  .|..|:..:.:..:  |..:
  Rat   362 VQDLLDFKDKVDHVVE-VCFQRNERFINLMKESFETFINKRPN--KPAELIAKHVDSKL--RAGN 421

  Fly   346 EEAIIDELKRIVKCVEFLSDEYKFID-------MYLKALRIRQINETSTSDGVESIMYSLLNKKM 403
            :||..:||:||:..:..|   ::||.       .|.|.|..|.:...|.|...|..|.|.|..:.
  Rat   422 KEATDEELERILDKIMIL---FRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHEC 483

  Fly   404 ANFVTRCIYVQLRDVDKLRTLKKEFQDHLNSKGIK---------LGFDFRPKCFKNDGSFENFNL 459
            ....|..:....:|::..:.:...|:.|:.::...         |...:.|       ::....:
  Rat   484 GAAFTSKLEGMFKDMELSKDIMVHFKQHMQNQSAPGPIDLTVNILTMGYWP-------TYTPMEV 541

  Fly   460 TLPDELQQAWKEFRIFY----EARKLQSKAIIQLNNELSSGEITCHLNQSVYILEVSTLQMAVLM 520
            .||.|:.:..:.|:.||    ..|||      |....|....:.....:.....:||..|..||:
  Rat   542 HLPPEMVRLQEVFKTFYLGKHSGRKL------QWQTTLGHAVLKADFKEGKKEFQVSLFQTLVLL 600

  Fly   521 LFNRHERFTEQELVTALGVELETLQEALKQI---KFLVYIEVNKVNYIE------INMDFTNRKR 576
            :||..:.|:.:|:..|.|:|...|:..|:.:   |..|.|:..|...:|      .|.||.::..
  Rat   601 MFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNADFKHKLF 665

  Fly   577 RLFCNEPLPRKMRKIEEKSEIELKIR--------RDKQVDAAIVRIMKGQKQLEYSELISLVYEE 633
            |:        |:.:|:.|..:|.::.        |..|:|||||||||.:|.|.::.|:|.:|.:
  Rat   666 RI--------KINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQ 722

  Fly   634 LKDRVKPQVSFIKKRLDYLVEREYLERD-NYYNIYRYL 670
            ||..|||  ..:|||::.|::|:|:||| :..|.|.|:
  Rat   723 LKFPVKP--GDLKKRIESLIDRDYMERDKDSPNQYHYV 758

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 164/752 (22%)
CULLIN 362..500 CDD:214545 30/158 (19%)
Cullin_Nedd8 606..661 CDD:287520 28/55 (51%)
Cul4aNP_001120773.1 Cullin 65..659 CDD:279260 121/634 (19%)
CULLIN 442..582 CDD:214545 29/153 (19%)
Cullin_Nedd8 688..753 CDD:214883 30/67 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.