DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and Cul4

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001163084.1 Gene:Cul4 FlyBaseID:FBgn0033260 Length:821 Species:Drosophila melanogaster

Alignment Length:738 Identity:158/739 (21%)
Similarity:296/739 (40%) Gaps:173/739 (23%)


  Fly    40 LMHLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSDCLMKRLKNIAWVMENQLDDNKPIRLIAKYL 104
            |..||..:...|         :.|....||..|.:...:.:|....:.|........:.|:.| :
  Fly   142 LEELYQAVVNMC---------SHKMDAQLYAKLKELTEQHVKRNIKLKELTGGSMDKLILLEK-I 196

  Fly   105 EHWVPYQRSCEKLNLACYHFNRNWVERERLKGDKETYPIYRLAMISWKELVFEPSVTILAAIRLI 169
            .||  :...|:::.:....|  .:::|..:..:...:.|:.:.:..::....:.||.....:..:
  Fly   197 NHW--WLSFCQQMIMIRSIF--LYMDRTYVLQNSTVHSIWDMGLDLFRIHFAQNSVVQKRTVDGL 257

  Fly   170 LSQMPREYNKSLEYQVYQVLQSIVELYANDKYQDVSLPSRIDKIFTEKVMD----FYKSTTLHEF 230
            |:.:.:|...|...:  .:|:|:|.:..:.:....|        |.||.:|    .||:.:..:.
  Fly   258 LTLIEKERQGSTVDR--GLLKSLVRMLCDLQIYTSS--------FEEKFLDATNQLYKAESQRKM 312

  Fly   231 QKIVV-----------SNDYKDFKHFLRYACLAMPEIEN------GTQFKAILKRYLAARLQETR 278
            |::.|           :.:.:..:|:|. :....|.|.|      .....:||::.|.:.|::.|
  Fly   313 QELEVPEYLQHVNKRLAEENERLRHYLD-SSTKHPLIYNVEKELLAEHLTSILQKGLDSLLEDNR 376

  Fly   279 LSGKDYIQAFLGLCRGPLQRALRDHTKLAEVVDAVCKEEINRKGQ--IIDP-------------- 327
            ||.       |.|..|.|.|.....::|....:..    |.:||:  :|||              
  Fly   377 LSD-------LTLLYGLLSRVKNGTSELCGNFNGF----IKKKGRTIVIDPEKDKSMVQDLLDFK 430

  Fly   328 ------TRLLVTYANELMTKRQESEEAIIDELKRIVKCVEFLSDEYKFIDMYLKALRIRQINETS 386
                  .|....:..:.....:|:.|..|::  |..|..|.::   |::||     ::|..|:.:
  Fly   431 DKMDVIVRTCFEHNEKFTNSLREAFEFFINQ--RANKPAELIA---KYVDM-----KLRSGNKGT 485

  Fly   387 TSDGVES------IMYSLLNKK-------MANFVTRCIYVQLRDVDK----LRTLKKE------- 427
            |.:.:|.      :::..::.|       ..:...|.:..:...||.    |..||:|       
  Fly   486 TDEELEKTLDKIMVLFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDSEKSMLSKLKQECGGGFTS 550

  Fly   428 -----FQDHLNSKGIKLGFDFRPKCFKNDGSFENFNL------------------TLPDELQQAW 469
                 |:|...|:.|.:.  ||.....|:....|.:|                  |:|.:.....
  Fly   551 KLEGMFKDMELSRDINIA--FRGHALSNNRDVHNLDLCVSILTMGYWPTYAPTEVTMPPQFINPQ 613

  Fly   470 KEFRIFY----EARKLQSKAII---QLNNELSSGEITCHLNQSVYILEVSTLQMAVLMLFNRHER 527
            :.|..||    ..||||.:..:   .|..:..:|...         |.||..|..||:|||....
  Fly   614 QIFNKFYLEKHSGRKLQWQPTLGNCMLRAQFDAGPKE---------LLVSLFQALVLLLFNDKPV 669

  Fly   528 FTEQELVTALGVELETLQEALKQI---KFLVYIEVNKVNYI------EINMDFTNRKRRLFCNEP 583
            .:.:|::.|..:|...|:..|:.:   :..|..:..|...|      :.|.:|||:..|:..|:.
  Fly   670 LSYEEILAATLIEDGELRRTLQSLACGRARVITKTPKGREILDGDQFDFNNEFTNKLFRIKINQI 734

  Fly   584 LPRKMRKIEEKSEIELKIRRDK--QVDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIK 646
            ..::..  ||:...|.::.:|:  |:|||||||||.:|.|.::.||:.::.:|...|||  :.:|
  Fly   735 QMKETN--EEQKATEERVFQDRQYQIDAAIVRIMKMRKTLSHNLLITELFNQLTFPVKP--ADLK 795

  Fly   647 KRLDYLVEREYLERD----NYYN 665
            ||::.|::|:|:|||    |.||
  Fly   796 KRIESLIDRDYMERDKDNQNQYN 818

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 158/739 (21%)
CULLIN 362..500 CDD:214545 35/192 (18%)
Cullin_Nedd8 606..661 CDD:287520 26/55 (47%)
Cul4NP_001163084.1 Cullin 124..721 CDD:279260 119/636 (19%)
CULLIN 503..644 CDD:214545 27/143 (19%)
Cullin_Nedd8 750..815 CDD:214883 28/67 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89199840
eggNOG 1 0.900 E1_COG5647
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11932
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.