DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and Cul1

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_523655.1 Gene:Cul1 FlyBaseID:FBgn0015509 Length:774 Species:Drosophila melanogaster

Alignment Length:807 Identity:218/808 (27%)
Similarity:354/808 (44%) Gaps:171/808 (21%)


  Fly     1 MNR------VKRISNYFDSMLPLIDNILQVVNQIFDDYTSFDGQKLMHLYHLIYKQCAA------ 53
            |||      .:::.|..|....|::.|:||    |:...|....:.|..|..:|..|.:      
  Fly     1 MNRSGNSQTTQKLVNLDDIWSELVEGIMQV----FEHEKSLTRSQYMRFYTHVYDYCTSVSAAPS 61

  Fly    54 --ERNWNNPAQKNGRSLYIVLSDCLMKRLKNIAWVMENQLDDNKPIR----LIAKYLEHWVPYQR 112
              .......||..|:.||..|...|...|..:       |...|.|.    |:::|.:.|..||.
  Fly    62 GRSSGKTGGAQLVGKKLYDRLEQFLKSYLSEL-------LTKFKAISGEEVLLSRYTKQWKSYQF 119

  Fly   113 SCEKLNLACYHFNRNWVERERLKGDKETYPIYRLAMISWKELVF----EPSVTILAAIRLILSQM 173
            |...|:..|.:.|||||:||..:|.|..|.|||||:::||..:|    || ||     :.:|..:
  Fly   120 SSTVLDGICNYLNRNWVKRECEEGQKGIYKIYRLALVAWKGHLFQVLNEP-VT-----KAVLKSI 178

  Fly   174 PRE-----YNKSLEYQVYQVLQSIVELYANDKYQDV----------SLPSRI---DKIFTEKVMD 220
            ..|     .|:||   |..|::..|||..|::..|.          :..::.   ...|.||..|
  Fly   179 EEERQGKLINRSL---VRDVIECYVELSFNEEDTDAEQQKLSVYKQNFENKFIADTSAFYEKESD 240

  Fly   221 FYKSTT-------------------------------LH-------------------------E 229
            .:.||.                               ||                         |
  Fly   241 AFLSTNTVTEYLKHVENRLEEETQRVRGFNSKNGLSYLHETTADVLKSTCEEVLIEKHLKIFHTE 305

  Fly   230 FQKIVVSNDYKDFKHFLRYACLAMPEIENGTQFKAILKRYL-------AARLQETRLSG--KDYI 285
            ||.::.::...|.|..  |:.:|:.. :|.|..|:||:.::       .|:...|..:.  |.|:
  Fly   306 FQNLLNADRNDDLKRM--YSLVALSS-KNLTDLKSILENHILHQGTEAIAKCCTTDAANDPKTYV 367

  Fly   286 QAFLGLCR---GPLQRALRDHTKLAEVVDAVCKEEINRKGQII-----DPTRLLVTYANELMTKR 342
            |..|.:.:   ..:..|..:.......:|..|.:.||.....|     ....||..|.:.|:.|.
  Fly   368 QTILDVHKKYNALVLTAFNNDNGFVAALDKACGKFINSNVVTIANSASKSPELLAKYCDLLLKKS 432

  Fly   343 QESEE--AIIDELKRIVKCVEFLSDEYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNKKMAN 405
            .::.|  .:.|.|.:::...:::.|:..|...|.|.|..|.:|.||.||..|::|.|.|.:....
  Fly   433 SKNPEDKELEDNLNQVMVVFKYIEDKDVFQKYYSKMLAKRLVNHTSASDDAEAMMISKLKQTCGY 497

  Fly   406 FVTRCIYVQLRDVDKLRTLKKEFQDHLNSKGIKLGFDFRPKCFKNDGSFE---NFNLTLPDELQQ 467
            ..|..:....:|:...:.|...|:.:|..|.:.:..||..:.. :.||:.   :.|..||.||::
  Fly   498 EYTVKLQRMFQDIGVSKDLNSYFKQYLAEKNLTMEIDFGIEVL-SSGSWPFQLSNNFLLPSELER 561

  Fly   468 AWKEFRIFYEARKLQSKAIIQLN--NELSSGEITCHLNQ---SVYILEVSTLQMAVLMLFNRHER 527
            :.::|..||.||....|    ||  .::..||:..::|:   |.|.|:.||.||:||:.||....
  Fly   562 SVRQFNEFYAARHSGRK----LNWLYQMCKGELIMNVNRNNSSTYTLQASTFQMSVLLQFNDQLS 622

  Fly   528 FTEQELVTALGVELETLQEALKQI-KFLVYIEV-------NKV---NYIEINMDFTNRKRRLFCN 581
            ||.|:|..    ..:|.||.|.|: :.|:..:|       |.:   :.:|:.:|:.|:|||:..|
  Fly   623 FTVQQLQD----NTQTQQENLIQVLQILLKAKVLTSSDNENSLTPESTVELFLDYKNKKRRININ 683

  Fly   582 EPLPRKMRKIEEKSEIELKIRRDKQ--VDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSF 644
            :||..:: |:|::: :...|..|::  :.||||||||.:|:|.::.|||.|..:|..|.||:|..
  Fly   684 QPLKTEL-KVEQET-VHKHIEEDRKLLIQAAIVRIMKMRKRLNHTNLISEVLNQLSTRFKPKVPV 746

  Fly   645 IKKRLDYLVEREYLER-DNYYNIYRYL 670
            |||.:|.|:|:||||| :.:.:.|.||
  Fly   747 IKKCIDILIEKEYLERMEGHKDTYSYL 773

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 208/776 (27%)
CULLIN 362..500 CDD:214545 40/143 (28%)
Cullin_Nedd8 606..661 CDD:287520 30/58 (52%)
Cul1NP_523655.1 Cullin 21..669 CDD:279260 168/680 (25%)
CULLIN 454..593 CDD:214545 40/144 (28%)
Cullin_Nedd8 701..765 CDD:214883 32/64 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C241603369
eggNOG 1 0.900 E1_COG5647
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11932
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.