DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and Cul2

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_610117.1 Gene:Cul2 FlyBaseID:FBgn0032956 Length:753 Species:Drosophila melanogaster

Alignment Length:685 Identity:146/686 (21%)
Similarity:273/686 (40%) Gaps:137/686 (20%)


  Fly    99 LIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGDKETY------------------PIYR 145
            |:.:|...|:.|.:..:.|:....:.|:..::::::...:..|                  .|:|
  Fly    92 LLQRYYITWMEYSQGIKYLHQLYIYLNQQHIKKQKITDTESFYGNLSSDAAEQMEIGELGLDIWR 156

  Fly   146 LAMISW--KELVFEPSVTILAAIRLILSQM--PREYNKSLEYQVYQVLQSIVELYANDK------ 200
            |.||.:  .|||           |.||..:  .|..|.:|::...|::..::..:...:      
  Fly   157 LYMIEYLSSELV-----------RHILEGIAADRASNGTLDHHRVQIINGVIHSFVEVQDYKKTG 210

  Fly   201 ----YQDVSLPSRID---KIFTEKVMDFYKSTTLHEFQKIVV------SNDYKDFKH-------- 244
                ||::.....::   ..:|::........::.|:.:.|:      |...:.|.|        
  Fly   211 SLKLYQELFEGPMLEASGAYYTDEANKLLHRCSVSEYMQEVIRILEYESRRAQKFLHVSSLPKLR 275

  Fly   245 -------------FLRYACLAMPEIENGTQFK---AILK--------RYLAARLQETRLSGKDYI 285
                         |:...|..|...|.....:   .:||        ..:...|...:..|...:
  Fly   276 KECEEKFINDRLGFIYSECREMVSEERRQDLRNMYVVLKPIPDNLKSELITTFLDHIKSEGLQTV 340

  Fly   286 QAFLG--LCRGPLQRALRDHTKLAEVV--------------DAVCKEEINRKGQIIDPTR---LL 331
            .|..|  :....::..|:.|.|..|::              |..|...|||:.....|.|   .:
  Fly   341 SALKGENIHIAFVENMLKVHHKYQELIADVFENDSLFLSALDKACASVINRRPTERQPCRSAEYV 405

  Fly   332 VTYANELMTKRQESEEAIIDELKRIVKCVEFLSDEYKFIDMYLKALRIRQINETSTSDGVESIMY 396
            ..|.:.|:.|.:..|..|..:|...:...:::.|:..:...|.:.|..|.|:|.|.|...|..|.
  Fly   406 AKYCDTLLKKSKTCEAEIDQKLTNNITIFKYIEDKDVYQKFYSRLLAKRLIHEQSQSMDAEEGMI 470

  Fly   397 SLLNKKMANFVTRCIYVQLRDVDKLRTLKKEFQDHLNSKGIKLGFDFRPKCFKND----GSFENF 457
            :.|.:......|..::....|:.....|..:|..||....:.||.:...|..:..    ||.:..
  Fly   471 NRLKQACGYEFTNKLHRMFTDISVSVDLNNKFNTHLKDSNVDLGINLAIKVLQAGAWPLGSTQVI 535

  Fly   458 NLTLPDELQQAWKEFRIFYEARKLQSKAIIQLNNELSSGEI-TCHLNQSVYILEVSTLQMAVLML 521
            ...:|.|.:::.|.|..:|  .||.|...:...:.:..||: ..||.:| ||:.:.|.|||:::|
  Fly   536 PFAVPQEFEKSIKMFEDYY--HKLFSGRKLTWLHHMCHGELKLSHLKKS-YIVTMQTYQMAIILL 597

  Fly   522 FNRHERFTEQELVTALGVELETLQEALKQIKFLVYIEVNKVN----------YIEINMDFTNRKR 576
            |...:..:.:|:...|.:..||.|:.::.|     ||...:|          .||:|:|:||::.
  Fly   598 FETCDSLSCREIQNTLQLNDETFQKHMQPI-----IESKLLNASSENLAGETRIELNLDYTNKRT 657

  Fly   577 RLFCNEPLPRKMRKIEEKSEIELKIR---RDKQ--VDAAIVRIMKGQKQLEYSELISLVYEELKD 636
            :...:..|.:     |...|:|..|.   .|::  :.||||||||.:|.|:::.||..|....|.
  Fly   658 KFKISSALQK-----ETPQEVEHTINSVDEDRKLFLQAAIVRIMKARKVLKHNALIQEVLSLSKV 717

  Fly   637 RVKPQVSFIKKRLDYLVEREYLERD-NYYNIYRYL 670
            ...|.::.|||.::.|::::|:||. |..:.|.|:
  Fly   718 SFTPNIAMIKKCVESLIDKQYIERTANSGDEYSYM 752

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 146/684 (21%)
CULLIN 362..500 CDD:214545 32/143 (22%)
Cullin_Nedd8 606..661 CDD:287520 22/57 (39%)
Cul2NP_610117.1 Cullin 39..639 CDD:279260 109/566 (19%)
CULLIN 436..575 CDD:214545 32/141 (23%)
Cullin_Nedd8 680..745 CDD:214883 24/65 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89250073
eggNOG 1 0.900 E1_COG5647
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11932
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.