DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and Cul3

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_723909.2 Gene:Cul3 FlyBaseID:FBgn0261268 Length:934 Species:Drosophila melanogaster

Alignment Length:828 Identity:183/829 (22%)
Similarity:306/829 (37%) Gaps:249/829 (30%)


  Fly    10 YFDSMLPLIDNILQVVNQIFDDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSD 74
            |.:::...:.|.:|.:.:..:...||:     .||...|         |....|:|..||..|.:
  Fly   188 YVETIWASLKNAIQEIQKKNNSGLSFE-----QLYRNAY---------NMVLHKHGNRLYYGLRE 238

  Fly    75 CLMKRL--KNIAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGD 137
            .:.:.|  |..|.|:| .|..|    .:.|..:.|..:|.|...:.....:.:|.:|::      
  Fly   239 VVSEHLEHKVRADVLE-ALHSN----FLPKLNQAWTDHQTSMVMIRDILMYMDRVYVQQ------ 292

  Fly   138 KETYPIYRLAMISWKELVFEPSVTILAAIR--LILSQMPREYNKSLEY-QVYQVLQSIVELYAND 199
            :|...:|.|.:|.:::.|...| .|..|:|  |:...|...:.:::.: .:......::.|..|.
  Fly   293 REVDNVYNLGLILFRDQVVRYS-EIQKALREKLLGMVMEERHGEAINHLAIKNACSMLITLGINS 356

  Fly   200 K--YQDVSLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVSND---------------------YKD 241
            :  |::     ..:|.|..:...|||    .|.|..:..|:                     |.|
  Fly   357 RTVYEE-----DFEKPFLAQSAAFYK----FESQNFLAENNAGVYIKKVEARITEESSRAALYLD 412

  Fly   242 ---------------FKHFLRYACLAMPEIENG----------TQFKAILKRYLAARLQETRLSG 281
                           .|..:|    .:.|:||.          |:..|...: |.:||:|..|..
  Fly   413 KDTEPRIVRVVEEELIKKHMR----PIVEMENSGVVYMIKNSKTEDLACTYK-LFSRLKEEGLKV 472

  Fly   282 -KDYIQAFLGLCRGPLQRALRDHTKLAEVVDAVCKEEINRKGQIIDPTR------------LLVT 333
             .|.:.|:           ||:..::      :.|||.|.....|...:            |:.:
  Fly   473 IADTMSAY-----------LREQGRM------LVKEEENGNTNPITFVQNLLDLKDRFDQFLVHS 520

  Fly   334 YANE----------------LMTKRQE-----------------SEEAIIDELKRIVKCVEFLSD 365
            :||:                |..|..|                 ||:.|...|.:.:....||.:
  Fly   521 FANDRIFKNVISSDFEHFLNLNNKSPEYLSLFIDDKLKKGGKGMSEQEIESILDKTMVLFRFLLE 585

  Fly   366 EYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRTLKKEFQD 430
            :..|...|...|..|.:...|.||..|..|.|.|..:.....|..:....:|:....|:..||::
  Fly   586 KDVFERYYKTHLAKRLLLNKSVSDDFEKNMISKLKTECGCQFTSKLEGMFKDMSVSNTIMDEFKN 650

  Fly   431 HLNSKGIKLG--------------------------------FDFRPKCFKNDGSFENF------ 457
            .:|:..:.||                                ||.          |:||      
  Fly   651 FVNNNNLSLGGVELTVRILTTGFWPTQTATPNCNIPAAPREAFDI----------FKNFYLNKHS 705

  Fly   458 --NLTLPDELQQAWKEFRIFYEARKLQSKAIIQLNNELSSGEITCHLNQSV--YILEVSTLQMAV 518
              .|||..::..|:.. .:||..:.::|:......:..|||   |.:..:.  :||:|||.||.|
  Fly   706 GRQLTLQPQMGTAYIN-AVFYGRKAVESEKDKDAPSSSSSG---CGVPTTTRKHILQVSTYQMCV 766

  Fly   519 LMLFNRHERFT-----------EQELVTALGVELETLQEALKQIKFLVYIEVNKVNYIEINMDFT 572
            |:|||..:..|           |:|||.|    |::|.......:.||.....|...||...:| 
  Fly   767 LLLFNNRDVLTYDDIHQETDIPERELVRA----LQSLSMGKPAQRLLVRNSKTKTKDIEPTDEF- 826

  Fly   573 NRKRRLFCNEPLPRKMRKIE------------EKSEIELKIRRDK--QVDAAIVRIMKGQKQLEY 623
                  :.|:....|..:::            |:.|...|:..|:  :::||||||||.:|:|.:
  Fly   827 ------YVNDAFNSKFHRVKIQTVAAKGESEPERKETRGKVDEDRKHEIEAAIVRIMKARKRLAH 885

  Fly   624 SELISLVYEELKDRVKPQVSFIKKRLDYLVEREYLERD-NYYNIYRYL 670
            :.|:|.|..:||.|..|...|||||::.|:|||||:|. ....:|.||
  Fly   886 NLLVSDVTSQLKSRFLPSPVFIKKRIEGLIEREYLQRSPEDRKVYNYL 933

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 179/812 (22%)
CULLIN 362..500 CDD:214545 36/178 (20%)
Cullin_Nedd8 606..661 CDD:287520 29/55 (53%)
Cul3NP_723909.2 Cullin 196..831 CDD:279260 145/717 (20%)
CULLIN 582..724 CDD:214545 30/153 (20%)
Cullin_Nedd8 866..926 CDD:287520 29/60 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89213767
eggNOG 1 0.900 E1_COG5647
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11932
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.