DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and cul2

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:XP_002666627.1 Gene:cul2 ZFINID:ZDB-GENE-030131-8032 Length:745 Species:Danio rerio

Alignment Length:796 Identity:161/797 (20%)
Similarity:310/797 (39%) Gaps:188/797 (24%)


  Fly     1 MNRVKRISNYFDSMLPLIDNILQVV----------NQIFDDYTSFDGQKLMHLYHLIYKQCAAER 55
            |:...|:.::.::...|:..|..||          |..|.|               ||..|.|  
Zfish     1 MSLKPRVVDFDETWNKLLTTIRAVVMLDYVERATWNDRFSD---------------IYALCVA-- 48

  Fly    56 NWNNPAQKNGRSLY----IVLSDCLMKRLKNIAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEK 116
             :..|.   |..||    :.|.:.:.:..|.   |:|::      .:::..|..:|..|.:..|.
Zfish    49 -YPEPL---GEKLYTETKVFLENHVRQLFKR---VLESE------EKVLVMYHRYWEEYSKGAEY 100

  Fly   117 LNLACYHFNRNWVERERLKGDKETY------------PIYRLAMISWKELVFEPSVTILAAIRLI 169
            ::....:.|..::::.:|......|            .|..||:..|::|:.||...:|  |..:
Zfish   101 MDCLYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMIEPLQPML--IGKL 163

  Fly   170 LSQMPREY-----NKSLEYQVYQVLQSIVELYANDK------YQDVSLPSRIDKIFTEKVMDFYK 223
            |.::..:.     |:.:   ::.|:.|.|.:....|      ||::     .:..|..|..::||
Zfish   164 LKEIKNDRCGEDPNQKV---IHGVINSFVHVEQYKKKFPLKFYQEI-----FEGPFLTKTGEYYK 220

  Fly   224 ---------------------------------------STTLHEFQKIVVSNDYKDFKHFLRYA 249
                                                   |..:||.|:.:|:    |...||...
Zfish   221 QEASNLLQESNCSQYMEKVLGRLKDEEVRCRKYLHPSSYSKVIHECQQRMVA----DHLQFLHGE 281

  Fly   250 C---LAMPEIENGTQFKAILKRY---LAARLQETRLSGKDY-IQAFLGLCRGPL-----QRALRD 302
            |   :...:.::......:|:..   |...:||.::...|. |:|.:.|.:..:     :..|..
Zfish   282 CQNIIRQEKRDDMANMYTLLRAVSSGLPHMIQELQVHIHDEGIRATINLSQENMPTLFVESVLEV 346

  Fly   303 HTKLAEVVDAVCKEE--------------INRK--GQIIDPTRLLVTYANELMTKRQE--SEEAI 349
            |:|..::::.|...:              :|.:  ..|.....||..|.:.|:.|..:  :|..:
Zfish   347 HSKFVQLINTVLNGDQHFMSALDKALTSVVNYREPKSICKAPELLAKYCDNLLKKSAKGMTENEV 411

  Fly   350 IDELKRIVKCVEFLSDEYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQ 414
            .|:|...:...:::.|:..|..:|.:.|..|.|:..|.|...|..|.:.|.:......|..::..
Zfish   412 EDKLTSFITVFKYIDDKDVFQKIYARMLAKRLIHGLSLSMDSEEAMINKLKQACGYEFTSKLHRM 476

  Fly   415 LRDVDKLRTLKKEFQDHLNSKG--IKLGFDFR---------PKCFKNDGSFENFNLTLPDELQQA 468
            ..|:.....|..:|.:.:.::.  :.||..|:         |.......:|     .:|.||:::
Zfish   477 YTDMSVSTDLNNKFNNFIKTQETVVDLGISFQIYVLQAGAWPLTHVPSSTF-----AIPQELEKS 536

  Fly   469 WKEFRIFY----EARKLQSKAIIQLNNELSSGEITCHLNQSVYILEVSTLQMAVLMLFNRHERFT 529
            .:.|.:||    ..|||      ...:.|.:||:..:.....|:..|:|.|||||:.||..|..:
Zfish   537 VQMFELFYNQHFSGRKL------TWLHYLCTGEVKMNYLSKPYVAVVTTYQMAVLLAFNNSETVS 595

  Fly   530 EQELVTALGVELETLQEALKQIKFLVYI-------EVNKVNYIEINMDFTNRKRRLFCNEPLPRK 587
            .:||..:..:..:.||:.:|.:..:..|       |:...:...:.|.||:::.:......:.:.
Zfish   596 YKELQDSTQMNEKELQKTIKSLLDVKMISHDLQKEEIEPESTFSLIMSFTSKRTKFKITTSMQKD 660

  Fly   588 MRKIEEKSEIELKIRRDKQVDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIKKRLDYL 652
            ..:..|::...:...|...:.||||||||.:|.|.::.||..|..:.|.|..|.:|.|||.::.|
Zfish   661 TPQELEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVINQSKARFNPSISMIKKCIEVL 725

  Fly   653 VEREYLER-----DNY 663
            ::::|:||     |.|
Zfish   726 IDKQYIERSQSSADEY 741

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 156/773 (20%)
CULLIN 362..500 CDD:214545 32/153 (21%)
Cullin_Nedd8 606..661 CDD:287520 24/60 (40%)
cul2XP_002666627.1 Cullin 15..640 CDD:307166 128/680 (19%)
Cullin_Nedd8 672..739 CDD:214883 25/67 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.