DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and cul5a

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001314988.1 Gene:cul5a ZFINID:ZDB-GENE-030131-5426 Length:780 Species:Danio rerio

Alignment Length:819 Identity:170/820 (21%)
Similarity:320/820 (39%) Gaps:217/820 (26%)


  Fly    11 FDSMLPLIDNILQ----VVNQIFDDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLYIV 71
            :|.|.|::..:|:    ...|.||.::.            ::..|.    |::   |....::..
Zfish    19 WDLMRPIVLKLLRQESVTKQQWFDQFSD------------VHAVCL----WDD---KGPAKIHQA 64

  Fly    72 LSDCLMKRLKNI-AWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERE--R 133
            |.:.::..:|.. |.|:.:| ||.   .|:..|:..|..:...|:.|...........:.::  .
Zfish    65 LKEDILDFIKQAQARVLSHQ-DDT---ALLKAYIVEWRKFFTQCDILPKPFCQLEITLMGKQGSS 125

  Fly   134 LKGDKETYPIYRLAMISWKELVFEPSVTIL--AAIRLI-LSQMPREYNKSLEYQVYQVLQSIVEL 195
            .|.:.|...:.:|.:.:|.|.:|......|  :|::|: ..::...::..|   |..|.:|.|.|
Zfish   126 KKSNVEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQL---VIGVRESYVNL 187

  Fly   196 YAN--DK---YQDVSLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVSNDYKDFKHFLRYACLAMPE 255
            .:|  ||   |:|     ..:|.:.:....||::......|:..|.|       :::||...:.|
Zfish   188 CSNPEDKLQIYRD-----NFEKSYLDSTERFYRTQAPSYLQQNGVQN-------YMKYADAKLRE 240

  Fly   256 IENGTQFKAILKRYLAAR--------LQETRLSG--KDYIQAFLGLCRG---------------- 294
            .|.    :|:  |||..|        |.|..::.  ..:.:..|..|.|                
Zfish   241 EEK----RAL--RYLETRRECNSVQALMECCVNALVTSFKETILAECPGMIKRNETDKLHLMFSL 299

  Fly   295 ---------PLQRALRDHTKLAEVVDAVCKEE----------------INRKGQII------DP- 327
                     |:.:.|.:|...|.:.|.|...|                .||..:::      || 
Zfish   300 MDKVPNGIEPMLKDLEEHIISAGLADMVAAAETITTDSEKYVEQLLTLFNRFSKLVKEAFQDDPR 364

  Fly   328 ----------------------------------------TRLLVTYANELMTK----RQESEEA 348
                                                    ..||..|.:.|:.|    ::.:.|.
Zfish   365 FLTARDKAYKAVVNDATIFKLELPMKQKGVGLKTQPESKCPELLANYCDMLLRKTPLSKKLTSED 429

  Fly   349 IIDELKRIVKCVEFLSDEYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNK--KMANFVTRC- 410
            |..:||.::..::::.::..|:..:...|..|.|.:.|....:|..|...|.:  ..|::|.:. 
Zfish   430 IELKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWLREVGMPADYVNKLA 494

  Fly   411 -IYVQLRDVDKLRTLKKEFQDH------LNSKGIKLGFDFRPKCFKNDG----SFENFNLTLPDE 464
             ::..::..:.|..:.||...|      .:|..||:         .|.|    |.|...::||.|
Zfish   495 RMFQDIKVSEDLNQVFKEMHKHNKLALPADSVNIKI---------LNAGAWSRSSEKVFVSLPTE 550

  Fly   465 LQQAWKEFRIFYEARKLQSKAIIQLNNELSSGEITCHLNQSVYILEVSTLQMAVLMLFNRHER-- 527
            |:....|...||  :|..|...:..::.:|:|.||.......|.|||:|.|:|||..:|:..|  
Zfish   551 LEDLIPEVEDFY--KKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREK 613

  Fly   528 --FTEQELVTAL-GVEL-ETLQE--ALKQIKFLVYIEVNKV----NYIEINMDFTNRKRRLFCNE 582
              |...:|.|.| ..|| .||..  |..::|..|.:...:|    ::.:..:.|.|::..|..|.
Zfish   614 ISFENLKLATELPDAELRRTLWSLVAFPKLKRQVLLYEPQVSSPKDFTDSTLFFVNQEFSLIKNS 678

  Fly   583 PLPR---------------KMRKIEEKSEIELKIRRDKQVDAAIVRIMKGQKQLEYSELISLVYE 632
            ...:               :||:.|.:..::|:|.|.::   ||::|||.:|::..::|.:.:.|
Zfish   679 KAQKRGKINLIGRLQLTTERMREEENEGIVQLRILRTQE---AIIQIMKMRKKITNAQLQTELVE 740

  Fly   633 ELKDRVKPQVSFIKKRLDYLVEREYLERDNY-YNIYRYL 670
            .||:...||...||:::::|:|.:|::||.. .|.:.|:
Zfish   741 ILKNMFLPQKKMIKEQIEWLIEHKYIKRDETDINTFIYM 779

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 166/800 (21%)
CULLIN 362..500 CDD:214545 34/152 (22%)
Cullin_Nedd8 606..661 CDD:287520 18/55 (33%)
cul5aNP_001314988.1 Cullin 20..671 CDD:279260 141/706 (20%)
CULLIN 443..586 CDD:214545 34/154 (22%)
Cullin_Nedd8 713..772 CDD:287520 20/62 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.