DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and cul3a

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_955985.2 Gene:cul3a ZFINID:ZDB-GENE-030131-3376 Length:774 Species:Danio rerio

Alignment Length:810 Identity:169/811 (21%)
Similarity:298/811 (37%) Gaps:214/811 (26%)


  Fly     5 KRISNYFDSMLPLIDNILQVVNQIFDDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLY 69
            |.::|.:|    |:.|.:|.:.:..:...||:     .||...|...         ..|:|..||
Zfish    34 KYVNNIWD----LLKNAIQEIQRKNNSGLSFE-----ELYRNAYTMV---------LHKHGEKLY 80

  Fly    70 IVLSDCLMKRLKN-IAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERER 133
            ..|.:.:.:.|.| :...:.:.|::|    .:....:.|..:|.:...:.....:.:|.:|::..
Zfish    81 TGLREVVTEHLINKVREDVLHSLNNN----FLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNN 141

  Fly   134 LKGDKETYPIYRLAMISWKELVFEPSVTILAAIR-----LILSQMPRE----------------- 176
            ::.      :|.|.:|     :|...|.....||     .:|..:.||                 
Zfish   142 VEN------VYNLGLI-----IFRDQVVRYGCIRDHLRQTLLDMIARERRGEVVDRGAIRNACQM 195

  Fly   177 -----------YNKSLEY-------QVYQ-------------VLQSIVELYANDKYQDVSLPSRI 210
                       |.:..|.       :.:|             |....||...|::.:.|.  ..:
Zfish   196 LMVLGLEGRSVYEEDFEIPFLDMSAEFFQMESQKFLAENSASVYIKKVEARINEEIERVM--HCL 258

  Fly   211 DKIFTEKVMDFYKSTTLHEFQKIVVSNDYKDFKHFLR------YACL--AMPEIENGTQFKAILK 267
            ||...|.::...:...:.:..|.:|..:.....|.|:      .||:  ....:.||      ||
Zfish   259 DKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLACMYKLFGRVPNG------LK 317

  Fly   268 RYLAARLQETRLSGK-------------DYIQAFLGLCRGPLQRALRDHTKLAEVVDAVCKEEI- 318
            ..........|..||             ||||..|.| :....|.|::...    .|.:.|:.| 
Zfish   318 TMCECMSWYLREQGKALVSEEGEGKNPVDYIQGLLDL-KSRFDRFLQESFN----NDRLFKQTIA 377

  Fly   319 ---------NRKGQIIDPTRLLVTYANELMTK-----RQESEEAIIDELKRIVKCVEFLSDEYKF 369
                     |.:.     ...|..:.::.:.|     .::..|:|:|:...:.:   |:.::..|
Zfish   378 GDFEYFLNLNSRS-----PEYLSLFIDDKLKKGVKGLTEQEVESILDKAMVLFR---FMQEKDVF 434

  Fly   370 IDMYLKALRIRQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRTLKKEFQDHLNS 434
            ...|.:.|..|.:...|.||..|..|.|.|..:.....|..:....||:....|...||:.||.:
Zfish   435 ERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNTTMDEFRHHLQT 499

  Fly   435 KGIKL-GFDF---------------RPKCFKNDGSFENFNLTLPDELQQAWKEFRIFYEARKLQS 483
            ..:.| |.|.               .|||            .:|...:.|::.||.||.|:  .|
Zfish   500 SQVSLCGVDLTVRVLTTGYWPTQSATPKC------------NIPPSPRHAFEVFRRFYLAK--HS 550

  Fly   484 KAIIQLNNELSSGEITCHL----------------------NQSVYILEVSTLQMAVLMLFNRHE 526
            ...:.|.:.:.|.::....                      |...:||:|||.||.:|||||..|
Zfish   551 GRQLTLQHHMGSADLNATFYGPIKKEDGSDVGVGGALLTGSNTRKHILQVSTFQMTILMLFNNRE 615

  Fly   527 RFTEQELVTALGVELETLQEALKQI-----------KFLVYIEVNKVNYIEINMDFTNRKRRLFC 580
            :||.:|:.....:....|..||:.:           |.....|:...:...:|..||::..|:..
Zfish   616 KFTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIESGHVFTVNDQFTSKLHRVKI 680

  Fly   581 NEPLPRKMRKIEEKSEIELKIRRDK--QVDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVS 643
            .....::.....|:.|...|:..|:  :::||||||||.:|:::::.|::.|.::|:.|..|...
Zfish   681 QTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLRARFLPSPV 745

  Fly   644 FIKKRLDYLVEREYLER---DNYYNIYRYL 670
            .||||::.|:|||||.|   |.  .:|.|:
Zfish   746 VIKKRIEGLIEREYLARTPEDR--KVYTYV 773

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 163/789 (21%)
CULLIN 362..500 CDD:214545 36/154 (23%)
Cullin_Nedd8 606..661 CDD:287520 25/58 (43%)
cul3aNP_955985.2 Cullin 41..670 CDD:279260 132/697 (19%)
CULLIN 427..569 CDD:214545 36/156 (23%)
Cullin_Nedd8 706..766 CDD:287520 25/60 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.