DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and cul1a

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_955953.2 Gene:cul1a ZFINID:ZDB-GENE-030131-2603 Length:777 Species:Danio rerio

Alignment Length:784 Identity:205/785 (26%)
Similarity:352/785 (45%) Gaps:162/785 (21%)


  Fly    25 VNQIFDD--------YT--SFDGQKLMHLYHLIYKQCAAERNWN----------NPAQKN----- 64
            ::||:||        ||  |....:.|.||..:|..|.:....|          .|::|.     
Zfish    17 LDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQVRGGGPAPSKPSKKTPTPGG 81

  Fly    65 ----GRSLYIVLSDCLMKRLKNIAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFN 125
                |..||..|.:.|...|.|:....|:.:|::    ::..|.:.|..|:.|.:.||..|.:.|
Zfish    82 AQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDES----VLKFYTQQWEDYRFSSKVLNGICAYLN 142

  Fly   126 RNWVERERLKGDKETYPIYRLAMISWKELVFEP---SVT--ILAAI-----------RLI----- 169
            |:||.||..:|.|..|.||.||:::|:|.:|.|   .||  :|..|           |||     
Zfish   143 RHWVRRECDEGRKGIYEIYSLALVTWRECLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQ 207

  Fly   170 ---------------------------------------------LSQMP-REYNKSLEYQVYQV 188
                                                         |.|.| .||.|..|.::.:.
Zfish   208 SYVELGLNEDDAFAKGPTLSVYKEYFETQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEE 272

  Fly   189 LQSIVELYANDKYQDVSLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVSNDYKDFKHFLRYACLAM 253
             |..|::|.::..|| .|..:.:::..||.::.:.:    |||.::.::..:|......    .:
Zfish   273 -QRRVQVYLHESTQD-ELARKCEQVLIEKHLEIFHT----EFQNLLDADKNEDLGRMYN----LV 327

  Fly   254 PEIENGT-QFKAILKRY-----LAA--RLQETRLSG-KDYIQAFLGLCR---GPLQRALRDHTKL 306
            ..|.:|. :.|.:|:.:     |||  :..|:.|:. |.|:|..|.:.:   ..:..|..:....
Zfish   328 SRITDGLGELKKLLETHIYNQGLAAIEKCGESALNDPKMYVQTILDVHKKYNALVMSAFNNDAGF 392

  Fly   307 AEVVDAVCKEEINRKG--QIIDPT----RLLVTYANELMTKRQES-EEA-IIDELKRIVKCVEFL 363
            ...:|..|...||...  :::..:    .||..|.:.|:.|..:: ||| :.|.|.:::...:::
Zfish   393 VAALDKACGRFINNNAVTKMVQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYI 457

  Fly   364 SDEYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRTLKKEF 428
            .|:..|...|.|.|..|.:::.|.||..|:.|.|.|.:......|..:....:|:...:.|.::|
Zfish   458 EDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQF 522

  Fly   429 QDHL-NSKGIKLGFDFRPKCFKNDGSF---ENFNLTLPDELQQAWKEFRIFYEARKLQSKAIIQL 489
            :.|| ||:.:.|.|..:   ..:.||:   ::....||.||:::::.|..||.:|....|  :..
Zfish   523 KKHLTNSEPLDLDFSIQ---VLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRK--LTW 582

  Fly   490 NNELSSGEITCHLNQSVYILEVSTLQMAVLMLFNRHERFTEQELVTALGVELETLQEALK---QI 551
            ...||.||:..:..::.|.|:.||.|||:|:.:|..:.:|.|:|..:..::::.|.:.|:   :.
Zfish   583 LYHLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDVYTVQQLTDSTQIKIDILVQVLQILLKS 647

  Fly   552 KFLVYIEVN-KVNYIEINMD--------FTNRKRRLFCNEPLPRKMRKIEEKSEIEL---KIRRD 604
            |.||..:.| .|:.:|...|        :.|:|.|:..|.|:     |.|:|.|.|.   .|..|
Zfish   648 KLLVLEDENANVDEVEFKPDTLIKLFLGYKNKKLRVNINVPM-----KTEQKQEQETTHKNIEED 707

  Fly   605 KQ--VDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIKKRLDYLVEREYLER-DNYYNI 666
            ::  :.||||||||.:|.|::.:|::.|..:|..|.||:|..|||.:|.|:|:||||| |...:.
Zfish   708 RKLLIQAAIVRIMKMRKVLKHQQLLAEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDT 772

  Fly   667 YRYL 670
            |.||
Zfish   773 YSYL 776

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 204/783 (26%)
CULLIN 362..500 CDD:214545 38/142 (27%)
Cullin_Nedd8 606..661 CDD:287520 28/58 (48%)
cul1aNP_955953.2 Cullin 22..661 CDD:307166 157/658 (24%)
Cullin_Nedd8 704..771 CDD:214883 31/67 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.