DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and Cul4b

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001100421.1 Gene:Cul4b RGDID:1564494 Length:971 Species:Rattus norvegicus

Alignment Length:753 Identity:167/754 (22%)
Similarity:301/754 (40%) Gaps:169/754 (22%)


  Fly    30 DDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSDCLMKRLKNI------AWVME 88
            ::||....|||......|....:.:.|.....|.........:|..|.|:|:.|      |.:.:
  Rat   268 ENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQ 332

  Fly    89 NQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGDKETYPIYRLAMISWKE 153
            .:.|....:..:.|....|..:.|....:.......:|.:|.:..:...     |:.:.:..::.
  Rat   333 FREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYVLQNSMLPS-----IWDMGLELFRA 392

  Fly   154 LVFEPSVTILAAIRLILSQMPREYN---------KSL-----EYQVYQ------VLQSIVELYAN 198
            .:..........|..||..:.||.|         :||     :.|:||      .||....|||.
  Rat   393 HIISDQKVQTKTIDGILLLIERERNGEAIDRSLLRSLLNMLSDLQIYQDSFEQRFLQETNRLYAA 457

  Fly   199 D---KYQDVSLPS---RIDKIFTE---KVMDFYKSTTLHEFQKIVVSNDYKDFKHFLRYACLAMP 254
            :   ..|:..:|.   .::|...|   :::.:...||    ||.::::..|...           
  Rat   458 EGQKLMQEREVPEYLHHVNKRLEEEADRLITYLDQTT----QKSLIASVEKQLL----------- 507

  Fly   255 EIENGTQFKAILKRYLAARLQETRLSGKDYIQAFLGLCRGPLQRAL------------------- 300
                |....|||::.|.:.|.|.|:.....:.......||.:|..|                   
  Rat   508 ----GEHLTAILQKGLNSLLDENRIQDLSLLYQLFSRVRGGVQVLLQHWIEYIKAFGSTIVINPE 568

  Fly   301 RDHTKLAEVVDAVCKEEINRKGQIID---------------------------PTRLLVTYANEL 338
            :|.|.:.|::|  .|::::   .|||                           |..|:..|.:..
  Rat   569 KDKTMVQELLD--FKDKVD---HIIDTCFLKNEKFINAMKEAFETFINKRPNKPAELIAKYVDSK 628

  Fly   339 MTKRQESEEAIIDELKRIVKCV----EFLSDEYKFIDMYLKALRIRQINETSTSDGVESIMYSLL 399
            :  |..::||..:||::::..:    .|:..:..|...|.|.|..|.:...|.|...|..|.|.|
  Rat   629 L--RAGNKEATDEELEKMLDKIMIIFRFIYGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKL 691

  Fly   400 NKKMANFVTRCIYVQLRDVDKLRTLKKEFQDHLNSKGIK---------LGFDFRPKCFKNDGSFE 455
            ..:.....|..:....:|::..:.:..:|:.::.::.:.         |...:.|       ::.
  Rat   692 KHECGAAFTSKLEGMFKDMELSKDIMIQFKQYMQNQNVPGNIELTVNILTMGYWP-------TYV 749

  Fly   456 NFNLTLPDELQQAWKEFRIFY----EARKLQSKAII---QLNNELSSGEITCHLNQSVYILEVST 513
            ...:.||.|:.:..:.|:.||    ..||||.::.:   .|..|...|:..         |:||.
  Rat   750 PMEVHLPPEMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKE---------LQVSL 805

  Fly   514 LQMAVLMLFNRHERFTEQELVTALGVELETLQEALKQI---KFLVYIEVNKVNYIE------INM 569
            .|..||::||..|.|:.:|:..|.|:|...|:..|:.:   |..|..:..|...||      .|.
  Rat   806 FQTLVLLMFNEGEEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICND 870

  Fly   570 DFTNRKRRLFCNEPLPRKMRK-IEEKSEIELKIRRDK--QVDAAIVRIMKGQKQLEYSELISLVY 631
            ||.::..|:..|:   .:|:: :||::....::.:|:  |:|||||||||.:|.|.::.|:|.||
  Rat   871 DFKHKLFRIKINQ---IQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVY 932

  Fly   632 EELKDRVKPQVSFIKKRLDYLVEREYLERD----NYYN 665
            .:||..|||  :.:|||::.|::|:|:|||    |.||
  Rat   933 NQLKFPVKP--ADLKKRIESLIDRDYMERDKENPNQYN 968

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 167/754 (22%)
CULLIN 362..500 CDD:214545 30/154 (19%)
Cullin_Nedd8 606..661 CDD:287520 29/55 (53%)
Cul4bNP_001100421.1 Cullin 276..871 CDD:279260 124/642 (19%)
CULLIN 654..794 CDD:214545 29/147 (20%)
Cullin_Nedd8 900..965 CDD:214883 31/67 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.