DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and Cul3

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001100393.1 Gene:Cul3 RGDID:1308190 Length:746 Species:Rattus norvegicus

Alignment Length:802 Identity:175/803 (22%)
Similarity:295/803 (37%) Gaps:204/803 (25%)


  Fly    10 YFDSMLPLIDNILQVVNQIFDDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSD 74
            |.:|:..|:.|.:|.:.:..:...||:     .||...|...         ..|:|..||..|.:
  Rat     7 YVNSIWDLLKNAIQEIQRKNNSGLSFE-----ELYRNAYTMV---------LHKHGEKLYTGLRE 57

  Fly    75 CLMKRLKN-IAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGDK 138
            .:.:.|.| :...:.|.|::|    .:....:.|..:|.:...:.....:.:|.:|::..::.  
  Rat    58 VVTEHLINKVPKDVLNSLNNN----FLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVEN-- 116

  Fly   139 ETYPIYRLAMISWKELVF---------------------EPSVTILAAIR------LILS----- 171
                :|.|.:|.:::.|.                     :..|....|||      :||.     
  Rat   117 ----VYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRS 177

  Fly   172 -----------QMPREY-----NKSLEYQVYQVLQSIVELYANDKYQDVSLPSRIDKIFTEKVMD 220
                       :|..|:     .|.|......|....||...|::.:.|.  ..:||...|.::.
  Rat   178 VYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEARINEEIERVM--HCLDKSTEEPIVK 240

  Fly   221 FYKSTTLHEFQKIVVSNDYKDFKHFLR------YACL--AMPEIENGTQFKAILKRYLAARLQET 277
            ..:...:.:..|.:|..:.....|.|:      .||:  ....:.||      ||..........
  Rat   241 VVERELISKHMKTIVEMENSGLVHMLKNGKTEDLACMYKLFSRVPNG------LKTMCECMSSYL 299

  Fly   278 RLSGK-------------DYIQAFLGLCRGPLQRALRDHTKLAEVVDAVCKEEINRKGQIIDPTR 329
            |..||             ||||..|.| :....|.|::...    .|.:.|:.|  .|..     
  Rat   300 REQGKALVSEEGEGKNPVDYIQGLLDL-KSRFDRFLQESFN----NDRLFKQTI--AGDF----- 352

  Fly   330 LLVTYANELMTKRQESEEAIIDE-LKRIVK----------------CVEFLSDEYKFIDMYLKAL 377
               .|...|.::..|.....||: ||:.||                ...|:.::..|...|.:.|
  Rat   353 ---EYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVETILDKAMVLFRFMQEKDVFERYYKQHL 414

  Fly   378 RIRQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRTLKKEFQDHLNSKGIKL-GF 441
            ..|.:...|.||..|..|.|.|..:.....|..:....||:....|...||:.||.:.|:.| |.
  Rat   415 ARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNTTMDEFRQHLQATGVSLGGV 479

  Fly   442 DF---------------RPKCFKNDGSFENFNLTLPDELQQAWKEFRIFYEARKLQSKAIIQLNN 491
            |.               .|||            .:|...:.|::.||.||.|:  .|...:.|.:
  Rat   480 DLTVRVLTTGYWPTQSATPKC------------NIPPAPRHAFEIFRRFYLAK--HSGRQLTLQH 530

  Fly   492 ELSSGEITCHL----------------------NQSVYILEVSTLQMAVLMLFNRHERFTEQELV 534
            .:.|.::....                      |...:||:|||.||.:|||||..|::|.:|:.
  Rat   531 HMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILMLFNNREKYTFEEIQ 595

  Fly   535 TALGVELETLQEALKQI-----------KFLVYIEVNKVNYIEINMDFTNRKRRLFCNEPLPRKM 588
            ....:....|..||:.:           |.....|:...:...:|..||::..|:.......::.
  Rat   596 QETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIESGHIFTVNDQFTSKLHRVKIQTVAAKQG 660

  Fly   589 RKIEEKSEIELKIRRDK--QVDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIKKRLDY 651
            ....|:.|...|:..|:  :::||||||||.:|:::::.|::.|.::||.|..|....||||::.
  Rat   661 ESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEG 725

  Fly   652 LVEREYLER---DNYYNIYRYL 670
            |:|||||.|   |.  .:|.|:
  Rat   726 LIEREYLARTPEDR--KVYTYV 745

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 170/786 (22%)
CULLIN 362..500 CDD:214545 37/154 (24%)
Cullin_Nedd8 606..661 CDD:287520 26/58 (45%)
Cul3NP_001100393.1 Cullin 13..642 CDD:279260 137/690 (20%)
CULLIN 399..541 CDD:214545 37/156 (24%)
Cullin_Nedd8 678..738 CDD:287520 26/60 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.