| Sequence 1: | NP_648620.1 | Gene: | Cul6 / 39474 | FlyBaseID: | FBgn0036332 | Length: | 670 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001342479.1 | Gene: | Cul1 / 26965 | MGIID: | 1349658 | Length: | 776 | Species: | Mus musculus | 
| Alignment Length: | 783 | Identity: | 204/783 - (26%) | 
|---|---|---|---|
| Similarity: | 348/783 - (44%) | Gaps: | 161/783 - (20%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    25 VNQIFDD--------YT--SFDGQKLMHLYHLIYKQCAAERNWNN------PAQKN--------- 64 
  Fly    65 ---GRSLYIVLSDCLMKRLKNIAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNR 126 
  Fly   127 NWVERERLKGDKETYPIYRLAMISWKELVFEP---SVT--ILAAI-----------RLI------ 169 
  Fly   170 --------------------------------------------LSQMP-REYNKSLEYQVYQVL 189 
  Fly   190 QSIVELYANDKYQDVSLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVSNDYKDFKHFLRYACLAMP 254 
  Fly   255 EIENGT-QFKAILKRY-----LAA--RLQETRLSG-KDYIQAFLGLCR---GPLQRALRDHTKLA 307 
  Fly   308 EVVDAVCKEEINRKG------QIIDPTRLLVTYANELMTKRQES-EEA-IIDELKRIVKCVEFLS 364 
  Fly   365 DEYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRTLKKEFQ 429 
  Fly   430 DHL-NSKGIKLGFDFRPKCFKNDGSF---ENFNLTLPDELQQAWKEFRIFYEARKLQSKAIIQLN 490 
  Fly   491 NELSSGEITCHLNQSVYILEVSTLQMAVLMLFNRHERFTEQELVTALGVELETLQEALK---QIK 552 
  Fly   553 FLVYIEVN-KVNYIEINMD--------FTNRKRRLFCNEPLPRKMRKIEEKSEIEL---KIRRDK 605 
  Fly   606 Q--VDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIKKRLDYLVEREYLER-DNYYNIY 667 
  Fly   668 RYL 670 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Cul6 | NP_648620.1 | COG5647 | 25..670 | CDD:227934 | 202/781 (26%) | 
| CULLIN | 362..500 | CDD:214545 | 38/141 (27%) | ||
| Cullin_Nedd8 | 606..661 | CDD:287520 | 28/57 (49%) | ||
| Cul1 | NP_001342479.1 | Cullin | 21..660 | CDD:395716 | 156/657 (24%) | 
| Cullin_Nedd8 | 706..767 | CDD:402267 | 29/60 (48%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5647 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S1033 | 
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1040292at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0003709 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR11932 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| 7 | 6.830 | |||||