DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and Cul3

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_057925.1 Gene:Cul3 MGIID:1347360 Length:768 Species:Mus musculus

Alignment Length:797 Identity:175/798 (22%)
Similarity:298/798 (37%) Gaps:194/798 (24%)


  Fly    10 YFDSMLPLIDNILQVVNQIFDDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSD 74
            |.:|:..|:.|.:|.:.:..:...||:     .||...|...         ..|:|..||..|.:
Mouse    29 YVNSIWDLLKNAIQEIQRKNNSGLSFE-----ELYRNAYTMV---------LHKHGEKLYTGLRE 79

  Fly    75 CLMKRLKN-IAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGDK 138
            .:.:.|.| :...:.|.|::|    .:....:.|..:|.:...:.....:.:|.:|::..::.  
Mouse    80 VVTEHLINKVREDVLNSLNNN----FLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVEN-- 138

  Fly   139 ETYPIYRLAMISWKELVF---------------------EPSVTILAAIR------LILS----- 171
                :|.|.:|.:::.|.                     :..|....|||      :||.     
Mouse   139 ----VYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRS 199

  Fly   172 -----------QMPREY-----NKSLEYQVYQVLQSIVELYANDKYQDVSLPSRIDKIFTEKVMD 220
                       :|..|:     .|.|......|....||...|::.:.|.  ..:||...|.::.
Mouse   200 VYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEARINEEIERVM--HCLDKSTEEPIVK 262

  Fly   221 FYKSTTLHEFQKIVVSNDYKDFKHFLR------YACL--AMPEIENGTQ-----FKAILKRYLAA 272
            ..:...:.:..|.:|..:.....|.|:      .||:  ....:.||.:     ....|:....|
Mouse   263 VVERELISKHMKTIVEMENSGLVHMLKNGKTEDLACMYKLFSRVPNGLKTMCECMSCYLREQGKA 327

  Fly   273 RLQETRLSGK---DYIQAFLGLCRGPLQRALRDHTKLAEVVDAVCKEEINRKGQIIDPTRLLVTY 334
            .:.|.. .||   ||||..|.| :....|.|::...    .|.:.|:.|  .|..        .|
Mouse   328 LVSEEG-EGKNPVDYIQGLLDL-KSRFDRFLQESFN----NDRLFKQTI--AGDF--------EY 376

  Fly   335 ANELMTKRQESEEAIIDE-LKRIVK----------------CVEFLSDEYKFIDMYLKALRIRQI 382
            ...|.::..|.....||: ||:.||                ...|:.::..|...|.:.|..|.:
Mouse   377 FLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVETILDKAMVLFRFMQEKDVFERYYKQHLARRLL 441

  Fly   383 NETSTSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRTLKKEFQDHLNSKGIKL-GFDF--- 443
            ...|.||..|..|.|.|..:.....|..:....||:....|...||:.||.:.|:.| |.|.   
Mouse   442 TNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNTTMDEFRQHLQATGVSLGGVDLTVR 506

  Fly   444 ------------RPKCFKNDGSFENFNLTLPDELQQAWKEFRIFYEARKLQSKAIIQLNNELSSG 496
                        .|||            .:|...:.|::.||.||.|:  .|...:.|.:.:.|.
Mouse   507 VLTTGYWPTQSATPKC------------NIPPAPRHAFEIFRRFYLAK--HSGRQLTLQHHMGSA 557

  Fly   497 EITCHL----------------------NQSVYILEVSTLQMAVLMLFNRHERFTEQELVTALGV 539
            ::....                      |...:||:|||.||.:|||||..|::|.:|:.....:
Mouse   558 DLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILMLFNNREKYTFEEIQQETDI 622

  Fly   540 ELETLQEALKQI-----------KFLVYIEVNKVNYIEINMDFTNRKRRLFCNEPLPRKMRKIEE 593
            ....|..||:.:           |.....|:...:...:|..||::..|:.......::.....|
Mouse   623 PERELVRALQSLACGKPTQRVLTKEPKSKEIESGHIFTVNDQFTSKLHRVKIQTVAAKQGESDPE 687

  Fly   594 KSEIELKIRRDK--QVDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIKKRLDYLVERE 656
            :.|...|:..|:  :::||||||||.:|:::::.|::.|.::||.|..|....||||::.|:|||
Mouse   688 RKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIERE 752

  Fly   657 YLER---DNYYNIYRYL 670
            ||.|   |.  .:|.|:
Mouse   753 YLARTPEDR--KVYTYV 767

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 170/781 (22%)
CULLIN 362..500 CDD:214545 37/154 (24%)
Cullin_Nedd8 606..661 CDD:287520 26/58 (45%)
Cul3NP_057925.1 Cullin 35..664 CDD:279260 137/685 (20%)
CULLIN 421..563 CDD:214545 37/156 (24%)
Cullin_Nedd8 700..760 CDD:287520 26/60 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.